Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.14
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8519 1.7e-11
medulloblastoma, large-cell 6241 3.2e-05
psoriasis 6694 1.4e-03
tuberculosis and treatment for 6 months 409 2.3e-03
lung cancer 4740 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 1.300 1.5e-02
medulloblastoma, large-cell 1.200 3.2e-05
ovarian cancer 1.500 1.7e-11
psoriasis -1.400 1.4e-03
tuberculosis and treatment for 6 months 1.100 2.3e-03

AA Sequence

MEESSSVAMLVPDIGEQEAILTAESIISPSLEIDEQRKTKPDPLIHVIQKLSKIVENEKSQKCLLIGKKR      1 - 70
PRSSAATHSLETQELCEIPAKVIQSPAADTRRAEMSQTNFTPDTLAQNEGKAMSYQCSLCKFLSSSFSVL     71 - 140
KDHIKQHGQQNEVILMCSECHITSRSQEELEAHVVNDHDNDANIHTQSKAQQCVSPSSSLCRKTTERNET    141 - 210
IPDIPVSVDNLQTHTVQTASVAEMGRRKWYAYEQYGMYRCLFCSYTCGQQRMLKTHAWKHAGEVDCSYPI    211 - 280
FENENEPLGLLDSSAAAAPGGVDAVVIAIGESELSIHNGPSVQVQICSSEQLSSSSPLEQSAERGVHLSQ    281 - 350
SVTLDPNEEEMLEVISDAEENLIPDSLLTSAQKIISSSPNKKGHVNVIVERLPSAEETLSQKRFLMNTEM    351 - 420
EEGKDLSLTEAQIGREGMDDVYRADKCTVDIGGLIIGWSSSEKKDELMNKGLATDENAPPGRRRTNSESL    421 - 490
RLHSLAAEALVTMPIRAAELTRANLGHYGDINLLDPDTSQRQVDSTLAAYSKMMSPLKNSSDGLTSLNQS    491 - 560
NSTLVALPEGRQELSDGQVKTGISMSLLTVIEKLRERTDQNASDDDILKELQDNAQCQPNSDTSLSGNNV    561 - 630
VEYIPNAERPYRCRLCHYTSGNKGYIKQHLRVHRQRQPYQCPICEHIADNSKDLESHMIHHCKTRIYQCK    631 - 700
QCEESFHYKSQLRNHEREQHSLPDTLSIATSNEPRISSDTADGKCVQEGNKSSVQKQYRCDVCDYTSTTY    701 - 770
VGVRNHRRIHNSDKPYRCSLCGYVCSHPPSLKSHMWKHASDQNYNYEQVNKAINDAISQSGRVLGKSPGK    771 - 840
TQLKSSEESADPVTGSSENAVSSSELMSQTPSEVLGTNENEKLSPTSNTSYSLEKISSLAPPSMEYCVLL    841 - 910
FCCCICGFESTSKENLLDHMKEHEGEIVNIILNKDHNTALNTN                               911 - 953
//

Text Mined References (10)

PMID Year Title