Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.34
PubTator Score 4.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -1.110 1.3e-05
Breast cancer -1.200 5.7e-10
glioblastoma -1.200 6.0e-04
ovarian cancer -1.200 3.6e-07
pancreatic ductal adenocarcinoma liver m... -1.669 3.2e-04
subependymal giant cell astrocytoma -1.008 3.2e-02

Gene RIF (8)

AA Sequence

MPFLGQDWRSPGWSWIKTEDGWKRCESCSQKLERENNRCNISHSIILNSEDGEIFNNEEHEYASKKRKKD      1 - 70
HFRNDTNTQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSL     71 - 140
SGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTLCILIRGVGKSVLVGNINIWICRLETILAWQ    141 - 210
QQLQDLQMTKQVNNGLTLSDLPLHMLNNILYRFSDGWDIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEK    211 - 280
QFCRHLILSEKGHIEWKLMYFALQKHYPAKEQYGDTLHFCRHCSILFWKDYHLALLFKDSGHPCTAADPD    281 - 350
SCFTPVSPQHFIDLFKF                                                         351 - 367
//

Text Mined References (16)

PMID Year Title