Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.68
PubTator Score 4.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -1.200 0.001
adrenocortical carcinoma -1.110 0.000
pancreatic ductal adenocarcinoma liver m... -1.669 0.000
subependymal giant cell astrocytoma -1.008 0.032
Breast cancer -1.200 0.000
ovarian cancer -1.400 0.000

Synonym

Accession Q8TCJ0 Q6PJ83 Q7Z4V4 Q9UKB8
Symbols FBX25

Gene

Gene RIF (6)

PMID Text
25419709 FBXO25 functions as a haploinsufficient tumor suppressor in mantle cell lymphoma.
23940030 FBXO25 mediates ELK-1 degradation through the ubiquitin proteasome system and thereby plays a role in regulating the activation of ELK-1 pathway in response to mitogens
21596019 Altogether, Fbxo25 acts as an ubiquitin E3 ligase to target cardiac transcription factors including Nkx2-5, Isl1, and Hand1, indicating that cardiac protein homeostasis through Fbxo25 has a pivotal impact on cardiac development.
20473970 Beta-actin, physically interacts through its N-terminus with FBXO25 and is enriched in the FBXO25 nuclear compartments.
18287534 The cellular distribution of FBXO25 and its colocalization with some nuclear proteins is investigated by using immunochemical and biochemical approaches.
16278047 investigated hFBX25's genomic organization and established hFBX25 as an FBP by verifying its interaction with Skp1 and Cul1

AA Sequence

MPFLGQDWRSPGWSWIKTEDGWKRCESCSQKLERENNRCNISHSIILNSEDGEIFNNEEHEYASKKRKKD      1 - 70
HFRNDTNTQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSL     71 - 140
SGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTLCILIRGVGKSVLVGNINIWICRLETILAWQ    141 - 210
QQLQDLQMTKQVNNGLTLSDLPLHMLNNILYRFSDGWDIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEK    211 - 280
QFCRHLILSEKGHIEWKLMYFALQKHYPAKEQYGDTLHFCRHCSILFWKDYHLALLFKDSGHPCTAADPD    281 - 350
SCFTPVSPQHFIDLFKF                                                         351 - 367
//

Text Mined References (14)

PMID Year Title
25419709 2014 Disruption of the PRKCD-FBXO25-HAX-1 axis attenuates the apoptotic response and drives lymphomagenesis.
23940030 2013 The F-box protein FBXO25 promotes the proteasome-dependent degradation of ELK-1 protein.
21596019 2011 A novel Fbxo25 acts as an E3 ligase for destructing cardiac specific transcription factors.
20473970 2010 Identification of FBXO25-interacting proteins using an integrated proteomics approach.
18287534 2008 FBXO25-associated nuclear domains: a novel subnuclear structure.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16278047 2006 Characterization of FBX25, encoding a novel brain-expressed F-box protein.
16249884 2006 Disruptions of the novel KIAA1202 gene are associated with X-linked mental retardation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...