Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.24
PubTator Score 10.69

Knowledge Summary

Patent (1,033)

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.792 0.009
cystic fibrosis -1.028 0.002
atypical teratoid / rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell 1.600 0.000
Breast cancer 3.700 0.022
interstitial cystitis 2.200 0.000
adult high grade glioma 1.300 0.002
lung carcinoma 2.200 0.000
ovarian cancer 1.500 0.000

Gene RIF (5)

PMID Text
23969981 Olfactory receptor 51E1 as a novel target for diagnosis in somatostatin receptor-negative lung carcinoids.
23184910 OR51E1 protein is a potential novel clinical tissue biomarker for small intestine neuroendocrine carcinomas.
16491480 expression of PSGR and PSGR2 relative to AMACR in prostate cancer; AMACR was the most overexpressed, but in some cases expression of AMACR was not significantly elevated while PSGR and/or PSGR2 were substantially elevated
16206286 Results suggest that PSGR2 may be useful as a tissue marker and molecular target for the early detection and treatment of human prostate cancers.
12732197 This publication uses 'GPR136' as a name for this gene.

AA Sequence

MVDPNGNESSATYFILIGLPGLEEAQFWLAFPLCSLYLIAVLGNLTIIYIVRTEHSLHEPMYIFLCMLSG      1 - 70
IDILISTSSMPKMLAIFWFNSTTIQFDACLLQMFAIHSLSGMESTVLLAMAFDRYVAICHPLRHATVLTL     71 - 140
PRVTKIGVAAVVRGAALMAPLPVFIKQLPFCRSNILSHSYCLHQDVMKLACDDIRVNVVYGLIVIISAIG    141 - 210
LDSLLISFSYLLILKTVLGLTREAQAKAFGTCVSHVCAVFIFYVPFIGLSMVHRFSKRRDSPLPVILANI    211 - 280
YLLVPPVLNPIVYGVKTKEIRQRILRLFHVATHASEP                                     281 - 317
//

Text Mined References (11)

PMID Year Title
23969981 2013 Olfactory receptor 51E1 as a novel target for diagnosis in somatostatin receptor-negative lung carcinoids.
23184910 2013 Olfactory receptor 51E1 protein as a potential novel tissue biomarker for small intestine neuroendocrine carcinomas.
16491480 2006 The prostate-specific G-protein coupled receptors PSGR and PSGR2 are prostate cancer biomarkers that are complementary to alpha-methylacyl-CoA racemase.
16206286 2006 PSGR2, a novel G-protein coupled receptor, is overexpressed in human prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15313197 2004 D-GPCR: a novel putative G protein-coupled receptor overexpressed in prostate cancer and prostate.
14983052 2004 The human olfactory receptor gene family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12732197 2003 Novel human G-protein-coupled receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...