Property Summary

NCBI Gene PubMed Count 12
PubMed Score 13.41
PubTator Score 10.69

Knowledge Summary

Patent (1,033)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Substance-Related Disorders 115 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Neuroendocrine carcinoma 3 3.437 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.300 1.7e-03
atypical teratoid / rhabdoid tumor 1.400 3.7e-04
Breast cancer 3.700 2.2e-02
cystic fibrosis -1.028 1.5e-03
interstitial cystitis 2.200 4.8e-05
lung carcinoma 2.200 4.1e-26
medulloblastoma, large-cell 1.600 3.2e-05
osteosarcoma -1.792 9.4e-03
ovarian cancer 1.500 2.4e-11

Gene RIF (6)

AA Sequence

MVDPNGNESSATYFILIGLPGLEEAQFWLAFPLCSLYLIAVLGNLTIIYIVRTEHSLHEPMYIFLCMLSG      1 - 70
IDILISTSSMPKMLAIFWFNSTTIQFDACLLQMFAIHSLSGMESTVLLAMAFDRYVAICHPLRHATVLTL     71 - 140
PRVTKIGVAAVVRGAALMAPLPVFIKQLPFCRSNILSHSYCLHQDVMKLACDDIRVNVVYGLIVIISAIG    141 - 210
LDSLLISFSYLLILKTVLGLTREAQAKAFGTCVSHVCAVFIFYVPFIGLSMVHRFSKRRDSPLPVILANI    211 - 280
YLLVPPVLNPIVYGVKTKEIRQRILRLFHVATHASEP                                     281 - 317
//

Text Mined References (12)

PMID Year Title