Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.21
PubTator Score 0.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
acute quadriplegic myopathy -1.824 9.7e-07
juvenile dermatomyositis -1.021 1.7e-08
lung adenocarcinoma 1.500 1.0e-10
malignant mesothelioma 1.100 3.2e-06
psoriasis 1.300 7.4e-04

Gene RIF (3)

AA Sequence

MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANNELKSLTSKFM      1 - 70
TTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKL     71 - 140
AAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPLP                              141 - 184
//

Text Mined References (14)

PMID Year Title