Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.21
PubTator Score 0.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis 1.300 0.001
juvenile dermatomyositis -1.021 0.000
acute quadriplegic myopathy -1.824 0.000
lung adenocarcinoma 1.500 0.000

Gene RIF (3)

PMID Text
20659327 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANNELKSLTSKFM      1 - 70
TTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKL     71 - 140
AAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPLP                              141 - 184
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23471985 2013 Genome-wide scan of healthy human connectome discovers SPON1 gene variant influencing dementia severity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20659327 2010 Trait-stratified genome-wide association study identifies novel and diverse genetic associations with serologic and cytokine phenotypes in systemic lupus erythematosus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...