Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.29
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -3.900 0.000
oligodendroglioma 1.100 0.000
cystic fibrosis 1.125 0.000
atypical teratoid / rhabdoid tumor -2.000 0.001
glioblastoma -1.200 0.007
medulloblastoma -1.300 0.014
medulloblastoma, large-cell -2.600 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.022
subependymal giant cell astrocytoma -1.230 0.032
ovarian cancer -1.200 0.001
Breast cancer -1.100 0.007
pituitary cancer 1.700 0.000

Synonym

Accession Q8TC76 Q5BM08 Q9Y4K2
Symbols C8orf72

Gene

Gene RIF (4)

PMID Text
21919029 FAM110B was able to regulate androgen receptor signaling in prostate cancer cells and FAM110B itself was regulated by androgens. FAM110B siRNA inhibited the growth of prostate cancer cells in vitro.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
17499476 Localizes to centrosomes and accumulates at the microtubule organization center in interphase and at spindle poles in mitosis; ectopic expression impairs cell cycle progression in the G1 phase.

AA Sequence

MPTETLQTGSMVKPVSPAGTFTSAVPLRILNKGPDYFRRQAEPNPKRLSAVERLEADKAKYVKSQEVINA      1 - 70
KQEPVKPAVLAKPPVCPAAKRALGSPTLKVFGNHAKTESGVQRENLKLEILKNIINSSEGSSSGSGHKHS     71 - 140
SRNWPPHRSEATDLHRHSFAESLKVYPTQGRRSPQEGGSHVGRRLLEQSAESFLHVSHSSSDIRKVTSVK    141 - 210
PLKAIPCSSSAPPLPPKPKIAAIASMKSPEADPVEPACGVSRRPSLQRSKSDLSDRYFRVDADVERFFNY    211 - 280
CGLDPEELENLGMENFARANSDIISLNFRSASMISSDCEQSQDSNSDLRNDDSANDRVPYGISAIERNAR    281 - 350
IIKWLYSIKQARESQKVSHV                                                      351 - 370
//

Text Mined References (19)

PMID Year Title
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24165912 2013 Genome-wide association study identifies 8 novel loci associated with blood pressure responses to interventions in Han Chinese.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21919029 2012 Integrative genomic, transcriptomic, and RNAi analysis indicates a potential oncogenic role for FAM110B in castration-resistant prostate cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
More...