Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.62
PubTator Score 0.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.126 4.0e-02
atypical teratoid / rhabdoid tumor 1.300 1.1e-03
Breast cancer -1.800 4.3e-06
intraductal papillary-mucinous carcinoma... -1.900 9.2e-03
medulloblastoma, large-cell -1.400 2.4e-02
non-small cell lung cancer 1.049 7.6e-06
osteosarcoma -1.016 9.2e-03
ovarian cancer -1.600 2.7e-04
pancreatic ductal adenocarcinoma liver m... -1.246 2.1e-02
tuberculosis 2.000 3.0e-07

Gene RIF (3)

AA Sequence

MGEEQSTVSGGGGPQESQTLASGTAGHPEPPRPQGDSARAPPLRAASAEPSGGGCGSDWGCADTSAPEPA      1 - 70
RSLGPPGWSKSRAPAQPAGLALTGPLNPQTLPLQLELEEEEEEAGDRKEGGDEQQEAPPGEELEPRTRVG     71 - 140
AADGLVLDVLGQRRPSLAKRQVFCSVYCVESDLPEAPASEQLSPPASPPGAPPVLNPPSTRSSFPSPRLS    141 - 210
LPTDSLSPDGGSIELEFYLAPEPFSMPSLLGAPPYSGLGGVGDPYVPLMVLMCRVCLEDKPIKPLPCCKK    211 - 280
AVCEECLKVYLSAQVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCK    281 - 350
HFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHEGVNCKEYKKGDKLLRHWASEIEHGQRNA    351 - 420
QKCPKCKIHIQRTEGCDHMTCSQCNTNFCYRCGERYRQLRFFGDHTSNLSIFGCKYRYLPERPHLRRLVR    421 - 490
GSVCAGKLFIAPLIMVLGLALGAIAVVIGLFVFPIYCLCKKQRKRSRTGMHW                      491 - 542
//

Text Mined References (11)

PMID Year Title