Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
Funding $50,833.34
PubMed Score 0.62
PubTator Score 0.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TC41 H7C5V4 Q5TCA4 Q9BX48
Symbols OSTL
IBRDC1
C6orf172
dJ84N20.1

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (3)

PMID Text
25298122 The high expression of RNF217 in certain human leukemias suggests that the deregulation of this gene could be a more common mechanism in leukemogenesis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGEEQSTVSGGGGPQESQTLASGTAGHPEPPRPQGDSARAPPLRAASAEPSGGGCGSDWGCADTSAPEPA      1 - 70
RSLGPPGWSKSRAPAQPAGLALTGPLNPQTLPLQLELEEEEEEAGDRKEGGDEQQEAPPGEELEPRTRVG     71 - 140
AADGLVLDVLGQRRPSLAKRQVFCSVYCVESDLPEAPASEQLSPPASPPGAPPVLNPPSTRSSFPSPRLS    141 - 210
LPTDSLSPDGGSIELEFYLAPEPFSMPSLLGAPPYSGLGGVGDPYVPLMVLMCRVCLEDKPIKPLPCCKK    211 - 280
AVCEECLKVYLSAQVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCK    281 - 350
HFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHEGVNCKEYKKGDKLLRHWASEIEHGQRNA    351 - 420
QKCPKCKIHIQRTEGCDHMTCSQCNTNFCYRCGERYRQLRFFGDHTSNLSIFGCKYRYLPERPHLRRLVR    421 - 490
GSVCAGKLFIAPLIMVLGLALGAIAVVIGLFVFPIYCLCKKQRKRSRTGMHW                      491 - 542
//

Text Mined References (11)

PMID Year Title
26216882 2015 Regulation of RNF144A E3 Ubiquitin Ligase Activity by Self-association through Its Transmembrane Domain.
25298122 2014 Identification and characterization of OSTL (RNF217) encoding a RING-IBR-RING protein adjacent to a translocation breakpoint involving ETV6 in childhood ALL.
24957874 2011 The Role of the Transmembrane RING Finger Proteins in Cellular and Organelle Function.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...