Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.83
PubTator Score 6.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q8TC36 A6NJ82 Q5T9R0
Symbols SPAG4L
SPGF16
TSARG4
dJ726C3.1

Gene

Gene RIF (2)

PMID Text
21711156 SPAG4L may play an important role in the meiotic stage of spermatogenesis
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPRSSRSPGDPGALLEDVAHNPRPRRIAQRGRNTSRMAEDTSPNMNDNILLPVRNNDQALGLTQCMLGCV      1 - 70
SWFTCFACSLRTQAQQVLFNTCRCKLLCQKLMEKTGILLLCAFGFWMFSIHLPSKMKVWQDDSINGPLQS     71 - 140
LRLYQEKVRHHSGEIQDLRGSMNQLIAKLQEMEAMSDEQKMAQKIMKMIHGDYIEKPDFALKSIGASIDF    141 - 210
EHTSVTYNHEKAHSYWNWIQLWNYAQPPDVILEPNVTPGNCWAFEGDRGQVTIQLAQKVYLSNLTLQHIP    211 - 280
KTISLSGSLDTAPKDFVIYGMEGSPKEEVFLGAFQFQPENIIQMFPLQNQPARAFSAVKVKISSNWGNPG    281 - 350
FTCLYRVRVHGSVAPPREQPHQNPYPKRD                                             351 - 379
//

Text Mined References (10)

PMID Year Title
21711156 2011 SPAG4L, a novel nuclear envelope protein involved in the meiotic stage of spermatogenesis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12621555 2003 [Cloning of cDNA of TSARG4, a human spermatogenesis related gene].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11988320 2002 Bypassing natural sperm selection during fertilization: the azh mutant offspring experience and the alternative of spermiogenesis in vitro.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10373309 1999 Spag4, a novel sperm protein, binds outer dense-fiber protein Odf1 and localizes to microtubules of manchette and axoneme.
9691178 1998 A novel testis-specific gene, SPAG4, whose product interacts specifically with outer dense fiber protein ODF27, maps to human chromosome 20q11.2.