Property Summary

NCBI Gene PubMed Count 12
PubMed Score 15.32
PubTator Score 6.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
SPERMATOGENIC FAILURE 16 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 6.4e-09
psoriasis 6694 9.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Male infertility 206 4.029 2.0

 GO Function (1)

 HCA RNA Cell Line (1)

Gene RIF (4)

AA Sequence

MPRSSRSPGDPGALLEDVAHNPRPRRIAQRGRNTSRMAEDTSPNMNDNILLPVRNNDQALGLTQCMLGCV      1 - 70
SWFTCFACSLRTQAQQVLFNTCRCKLLCQKLMEKTGILLLCAFGFWMFSIHLPSKMKVWQDDSINGPLQS     71 - 140
LRLYQEKVRHHSGEIQDLRGSMNQLIAKLQEMEAMSDEQKMAQKIMKMIHGDYIEKPDFALKSIGASIDF    141 - 210
EHTSVTYNHEKAHSYWNWIQLWNYAQPPDVILEPNVTPGNCWAFEGDRGQVTIQLAQKVYLSNLTLQHIP    211 - 280
KTISLSGSLDTAPKDFVIYGMEGSPKEEVFLGAFQFQPENIIQMFPLQNQPARAFSAVKVKISSNWGNPG    281 - 350
FTCLYRVRVHGSVAPPREQPHQNPYPKRD                                             351 - 379
//

Text Mined References (12)

PMID Year Title