Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.30
PubTator Score 5.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Retinitis pigmentosa 3 16 4.454 2.2

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma 1.358 7.5e-04
astrocytoma 1.500 4.5e-02
atypical teratoid / rhabdoid tumor 1.600 1.9e-03
colon cancer -1.400 1.4e-03
ependymoma 1.500 8.1e-08
group 3 medulloblastoma 1.600 1.1e-02
lung cancer 1.400 5.4e-03
malignant mesothelioma 1.500 3.1e-07
osteosarcoma -2.039 2.6e-06
ovarian cancer -1.200 2.3e-03
psoriasis -1.300 4.5e-07

Gene RIF (2)

AA Sequence

MPVRFKGLSEYQRNFLWKKSYLSESCNSSVGRKYPWAGLRSDQLGITKEPSFISKRRVPYHDPQISKSLE      1 - 70
WNGAISESNVVASPEPEAPETPKSQEAEQKDVTQERVHSLEASRVPKRTRSHSADSRAEGASDVENNEGV     71 - 140
TNHTPVNENVELEHSTKVLSENVDNGLDRLLRKKAGLTVVPSYNALRNSEYQRQFVWKTSKETAPAFAAN    141 - 210
QVFHNKSQFVPPFKGNSVIHETEYKRNFKGLSPVKEPKLRNDLRENRNLETVSPERKSNKIDDRLKLEAE    211 - 280
MELKDLHQPKRKLTPWKHQRLGKVNSEYRAKFLSPAQYLYKAGAWTHVKGNMPNQVKELREKAEFYRKRV    281 - 350
QGTHFSRDHLNQILSDSNCCWDVSSTTSSEGTVSSNIRALDLAGDPTSHKTLQKCPSTEPEEKGNIVEEQ    351 - 420
PQKNTTEKLGVSAPTIPVRRRLAWDTENTSEDVQKQPGEKEEEDDNEEEGDRKTGKQAFMGEQEKLDVRE    421 - 490
KSKADKMKEGSDSSVSSEKGGRLPTPKLRELGGIQRTHHDLTTPAVGGAVLVSPSKMKPPAPEQRKRMTS    491 - 560
QDCLETSKNDFTKKESRAVSLLTSPAAGIKTVDPLPLREDSEDNIHKFAEATLPVSKIPKYPTNPPGQLP    561 - 630
SPPHVPSYWHPSRRIQGSLRDPEFQHNVGKARMNNLQLPQHEAFNDEDEDRLSEISARSAASSLRAFQTL    631 - 700
ARAKKRKENFWGKT                                                            701 - 714
//

Text Mined References (16)

PMID Year Title