Property Summary

NCBI Gene PubMed Count 13
PubMed Score 107.77
PubTator Score 9.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 2.84881639970989E-26
osteosarcoma 7933 3.23565145028092E-6
gastric cancer 436 1.31399570359966E-4
medulloblastoma, large-cell 6234 9.14085472275851E-4
ovarian cancer 8492 0.00636013249814441
subependymal giant cell astrocytoma 2287 0.010008120817866
Rheumatoid Arthritis 1171 0.0146204511575966
group 3 medulloblastoma 2254 0.0338979840486226
astrocytic glioma 2241 0.0381016595154735

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.015
gastric cancer 1.100 0.000
astrocytic glioma -1.300 0.038
osteosarcoma -1.598 0.000
medulloblastoma, large-cell -1.100 0.001
group 3 medulloblastoma 1.100 0.034
subependymal giant cell astrocytoma -1.591 0.010
Breast cancer -1.700 0.000
ovarian cancer 1.400 0.006

Gene

PDB

5K1C   5K19  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
Fruitfly EggNOG Inparanoid

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (4)

PMID Text
26790128 our data suggest that downregulation of WDR20 due to 14q loss may be involved in the malignant transformation of ccRCCs, in part through activation of the ERK and protein kinase B/AKT pathways
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20147737 WDR20 serves as a stimulatory subunit for preserving and regulating the activity of the subset of the UAF1 x USP12 complexes
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATEGGGKEMNEIKTQFTTREGLYKLLPHSEYSRPNRVPFNSQGSNPVRVSFVNLNDQSGNGDRLCFNVG      1 - 70
RELYFYIYKGVRKAADLSKPIDKRIYKGTQPTCHDFNHLTATAESVSLLVGFSAGQVQLIDPIKKETSKL     71 - 140
FNEERLIDKSRVTCVKWVPGSESLFLVAHSSGNMYLYNVEHTCGTTAPHYQLLKQGESFAVHTCKSKSTR    141 - 210
NPLLKWTVGEGALNEFAFSPDGKFLACVSQDGFLRVFNFDSVELHGTMKSYFGGLLCVCWSPDGKYIVTG    211 - 280
GEDDLVTVWSFVDCRVIARGHGHKSWVSVVAFDPYTTSVEEGDPMEFSGSDEDFQDLLHFGRDRANSTQS    281 - 350
RLSKRNSTDSRPVSVTYRFGSVGQDTQLCLWDLTEDILFPHQPLSRARTHTNVMNATSPPAGSNGNSVTT    351 - 420
PGNSVPPPLPRSNSLPHSAVSNAGSKSSVMDGAIASGVSKFATLSLHDRKERHHEKDHKRNHSMGHISSK    421 - 490
SSDKLNLVTKTKTDPAKTLGTPLCPRMEDVPLLEPLICKKIAHERLTVLIFLEDCIVTACQEGFICTWGR    491 - 560
PGKVVSFNP                                                                 561 - 569
//

Text Mined References (22)

PMID Year Title
26790128 2016 Downregulation of WDR20 due to loss of 14q is involved in the malignant transformation of clear cell renal cell carcinoma.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20147737 2010 WDR20 regulates activity of the USP12 x UAF1 deubiquitinating enzyme complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...