Property Summary

NCBI Gene PubMed Count 15
PubMed Score 113.93
PubTator Score 9.49

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.300 3.8e-02
Breast cancer -1.700 2.8e-26
gastric cancer 1.100 1.3e-04
group 3 medulloblastoma 1.100 3.4e-02
medulloblastoma, large-cell -1.100 9.1e-04
osteosarcoma -1.388 2.8e-04
ovarian cancer -1.300 5.1e-05
Rheumatoid arthritis 1.400 1.5e-02
subependymal giant cell astrocytoma -1.591 1.0e-02

Gene RIF (5)

AA Sequence

MATEGGGKEMNEIKTQFTTREGLYKLLPHSEYSRPNRVPFNSQGSNPVRVSFVNLNDQSGNGDRLCFNVG      1 - 70
RELYFYIYKGVRKAADLSKPIDKRIYKGTQPTCHDFNHLTATAESVSLLVGFSAGQVQLIDPIKKETSKL     71 - 140
FNEERLIDKSRVTCVKWVPGSESLFLVAHSSGNMYLYNVEHTCGTTAPHYQLLKQGESFAVHTCKSKSTR    141 - 210
NPLLKWTVGEGALNEFAFSPDGKFLACVSQDGFLRVFNFDSVELHGTMKSYFGGLLCVCWSPDGKYIVTG    211 - 280
GEDDLVTVWSFVDCRVIARGHGHKSWVSVVAFDPYTTSVEEGDPMEFSGSDEDFQDLLHFGRDRANSTQS    281 - 350
RLSKRNSTDSRPVSVTYRFGSVGQDTQLCLWDLTEDILFPHQPLSRARTHTNVMNATSPPAGSNGNSVTT    351 - 420
PGNSVPPPLPRSNSLPHSAVSNAGSKSSVMDGAIASGVSKFATLSLHDRKERHHEKDHKRNHSMGHISSK    421 - 490
SSDKLNLVTKTKTDPAKTLGTPLCPRMEDVPLLEPLICKKIAHERLTVLIFLEDCIVTACQEGFICTWGR    491 - 560
PGKVVSFNP                                                                 561 - 569
//

Text Mined References (24)

PMID Year Title