Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 5.4e-08
Disease Target Count Z-score Confidence
Peutz-Jeghers syndrome 21 4.12 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.721 5.4e-08

Synonym

Accession Q8TBR5
Symbols C19orf23

 Compartment GO Term (0)

AA Sequence

MAPEVIRQDFQAGEVAFRRTGYLRGRSVLTQTKHSLAGNGRHPVALRTRLGSLALGAVPTWTKLWAQSTT      1 - 70
WQTRNHTRTGHAYPRFTRPSFPSCNRNGKRRKLRLGLPY                                    71 - 109
//

Text Mined References (4)

PMID Year Title