Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.300 1.9e-02
astrocytic glioma -2.100 2.4e-03
Astrocytoma, Pilocytic -1.900 4.6e-06
atypical teratoid / rhabdoid tumor -1.700 2.6e-05
ependymoma -1.900 8.8e-03
glioblastoma -1.200 1.1e-04
intraductal papillary-mucinous neoplasm ... 1.400 2.7e-03
medulloblastoma -1.300 1.3e-04
medulloblastoma, large-cell -1.500 3.3e-02
oligodendroglioma -1.700 9.2e-03
primitive neuroectodermal tumor -1.400 1.4e-02

AA Sequence

MENMHLRRVRTMPRHSQSLTMAPYSSVSLVEQLEDRILCHEKTTAALVEHAFRIKDDIVNSLQKMQNKGG      1 - 70
GDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKTLEMRQLSGLGDLRGRVARCD     71 - 140
ASIARLSAEHKTTYEGLQHLNKEQQAAKLILETKIKDAEGQISQLLNRVDLSISEQSTKLKMSHRDSNHQ    141 - 210
LQLLDTKFKGTVEELSNQILSARSWLQQEQERIEKELLQKIDQLSLIVKENSGASERDMEKKLSQMSARL    211 - 280
DKIEEGQKKTFDGQRTRQEEEKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSLRQVLEAKMKLD    281 - 350
RDQLQKQIQLMQKPETPM                                                        351 - 368
//

Text Mined References (6)

PMID Year Title