Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.09
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
osteosarcoma 3.494 0.000
tuberculosis and treatment for 6 months -1.500 0.000
ovarian cancer -2.100 0.000
Breast cancer -1.100 0.000
head and neck cancer and chronic obstruc... -1.400 0.000

AA Sequence

MVKCCSAIGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNAAGIWEPKKGDVLCSRHFKKTD      1 - 70
FDRSAPNIKLKPGVIPSIFDSPYHLQGKREKLHCRKNFTLKTVPATNYNHHLVGASSCIEEFQSQFIFEH     71 - 140
SYSVMDSPKKLKHKLDHVIGELEDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLDTFCWD    141 - 210
CCQESIEQDYIS                                                              211 - 222
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12575992 2003 The THAP domain: a novel protein motif with similarity to the DNA-binding domain of P element transposase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...