Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.09
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.100 1.9e-04
head and neck cancer and chronic obstruc... -1.400 2.1e-04
hepatocellular carcinoma 1.100 2.1e-04
osteosarcoma -1.492 4.5e-05
ovarian cancer -2.100 1.9e-13
tuberculosis -1.100 6.8e-06

AA Sequence

MVKCCSAIGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNAAGIWEPKKGDVLCSRHFKKTD      1 - 70
FDRSAPNIKLKPGVIPSIFDSPYHLQGKREKLHCRKNFTLKTVPATNYNHHLVGASSCIEEFQSQFIFEH     71 - 140
SYSVMDSPKKLKHKLDHVIGELEDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLDTFCWD    141 - 210
CCQESIEQDYIS                                                              211 - 222
//

Text Mined References (13)

PMID Year Title