Property Summary

NCBI Gene PubMed Count 20
PubMed Score 14.53
PubTator Score 15.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.028 2.6e-05
diabetes mellitus -1.300 1.1e-03
osteosarcoma 1.108 1.1e-03
ovarian cancer 2.400 9.3e-05
pancreatic ductal adenocarcinoma liver m... -1.254 7.2e-03
Waldenstrons macroglobulinemia 1.384 4.4e-03

Gene RIF (2)

AA Sequence

MSWFVDLAGKAEDLLNRVDQGAATALSRKDNASNIYSKNTDYTELHQQNTDLIYQTGPKSTYISSAADNI      1 - 70
RNQKATILAGTANVKVGSRTPVEASHPVENASVPRPSSHFVRRKKSEPDDELLFDFLNSSQKEPTGRVEI     71 - 140
RKEKGKTPVFQSSQTSSVSSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACPD    141 - 210
HTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMT    211 - 280
RGLRAQVDDLTEAVAAKDSQLAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTF    281 - 350
QERLHEADATLKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDELQQQVKLYKLN    351 - 420
LESSKQELIDYKQKATRILQSKEKLINSLKEGSGFEGLDSSTASSMELEELRHEKEMQREEIQKLMGQIH    421 - 490
QLRSELQDMEAQQVNEAESAREQLQDLHDQIAGQKASKQELETELERLKQEFHYIEEDLYRTKNTLQSRI    491 - 560
KDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNSAS    561 - 630
GSSSNGSSINMSGIDNGEGTRLRNVPVLFNDTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVF    631 - 700
VIIYMALLHLWVMIVLLTYTPEMHHDQPYGK                                           701 - 731
//

Text Mined References (25)

PMID Year Title