Property Summary

NCBI Gene PubMed Count 20
PubMed Score 14.53
PubTator Score 15.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.384 0.004
osteosarcoma 1.108 0.001
acute quadriplegic myopathy 1.028 0.000
pancreatic ductal adenocarcinoma liver m... -1.254 0.007
diabetes mellitus -1.300 0.001
ovarian cancer 2.400 0.000

Synonym

Accession Q8TBA6 C9JRU1 O95287 Q03962 Q2TS49 Q9UQQ7
Symbols RFG5
GOLIM5
ret-II

Gene

Gene RIF (2)

PMID Text
20874812 Golgin-84 on coat protein I vesicles interacts with the conserved oligomeric Golgi complex before SNARE assembly.
12656988 involved in generating and maintaining the architecture of the Golgi apparatus

AA Sequence

MSWFVDLAGKAEDLLNRVDQGAATALSRKDNASNIYSKNTDYTELHQQNTDLIYQTGPKSTYISSAADNI      1 - 70
RNQKATILAGTANVKVGSRTPVEASHPVENASVPRPSSHFVRRKKSEPDDELLFDFLNSSQKEPTGRVEI     71 - 140
RKEKGKTPVFQSSQTSSVSSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACPD    141 - 210
HTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMT    211 - 280
RGLRAQVDDLTEAVAAKDSQLAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTF    281 - 350
QERLHEADATLKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDELQQQVKLYKLN    351 - 420
LESSKQELIDYKQKATRILQSKEKLINSLKEGSGFEGLDSSTASSMELEELRHEKEMQREEIQKLMGQIH    421 - 490
QLRSELQDMEAQQVNEAESAREQLQDLHDQIAGQKASKQELETELERLKQEFHYIEEDLYRTKNTLQSRI    491 - 560
KDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNSAS    561 - 630
GSSSNGSSINMSGIDNGEGTRLRNVPVLFNDTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVF    631 - 700
VIIYMALLHLWVMIVLLTYTPEMHHDQPYGK                                           701 - 731
//

Text Mined References (25)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21990969 2011 Targeting of a chlamydial protease impedes intracellular bacterial growth.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20874812 2010 Interaction of Golgin-84 with the COG complex mediates the intra-Golgi retrograde transport.
19946888 2010 Defining the membrane proteome of NK cells.
19060882 2009 Chlamydia causes fragmentation of the Golgi compartment to ensure reproduction.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...