Property Summary

NCBI Gene PubMed Count 20
PubMed Score 14.53
PubTator Score 15.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Papillary thyroid carcinoma 37
Disease Target Count P-value
acute quadriplegic myopathy 1157 2.55577554427404E-5
ovarian cancer 8492 9.29206650199884E-5
osteosarcoma 7933 0.00110072234567022
diabetes mellitus 1663 0.00114917261793073
Waldenstrons macroglobulinemia 765 0.00441705468046263
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00717014913747088
Disease Target Count Z-score Confidence
Sigmoid colon cancer 3 3.848 1.9
Oculocerebrorenal syndrome 24 3.837 1.9

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.384 0.004
osteosarcoma 1.108 0.001
acute quadriplegic myopathy 1.028 0.000
pancreatic ductal adenocarcinoma liver m... -1.254 0.007
diabetes mellitus -1.300 0.001
ovarian cancer 2.400 0.000

Synonym

Accession Q8TBA6 C9JRU1 O95287 Q03962 Q2TS49 Q9UQQ7
Symbols RFG5
GOLIM5
ret-II

Gene

  Ortholog (16)

Gene RIF (2)

PMID Text
20874812 Golgin-84 on coat protein I vesicles interacts with the conserved oligomeric Golgi complex before SNARE assembly.
12656988 involved in generating and maintaining the architecture of the Golgi apparatus

AA Sequence

MSWFVDLAGKAEDLLNRVDQGAATALSRKDNASNIYSKNTDYTELHQQNTDLIYQTGPKSTYISSAADNI      1 - 70
RNQKATILAGTANVKVGSRTPVEASHPVENASVPRPSSHFVRRKKSEPDDELLFDFLNSSQKEPTGRVEI     71 - 140
RKEKGKTPVFQSSQTSSVSSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACPD    141 - 210
HTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMT    211 - 280
RGLRAQVDDLTEAVAAKDSQLAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTF    281 - 350
QERLHEADATLKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDELQQQVKLYKLN    351 - 420
LESSKQELIDYKQKATRILQSKEKLINSLKEGSGFEGLDSSTASSMELEELRHEKEMQREEIQKLMGQIH    421 - 490
QLRSELQDMEAQQVNEAESAREQLQDLHDQIAGQKASKQELETELERLKQEFHYIEEDLYRTKNTLQSRI    491 - 560
KDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNSAS    561 - 630
GSSSNGSSINMSGIDNGEGTRLRNVPVLFNDTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVF    631 - 700
VIIYMALLHLWVMIVLLTYTPEMHHDQPYGK                                           701 - 731
//

Text Mined References (25)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21990969 2011 Targeting of a chlamydial protease impedes intracellular bacterial growth.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20874812 2010 Interaction of Golgin-84 with the COG complex mediates the intra-Golgi retrograde transport.
19946888 2010 Defining the membrane proteome of NK cells.
19060882 2009 Chlamydia causes fragmentation of the Golgi compartment to ensure reproduction.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...