Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.62
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.200 8.4e-04
astrocytic glioma -2.000 2.7e-02
Astrocytoma, Pilocytic -1.400 2.6e-06
atypical teratoid / rhabdoid tumor -1.200 7.1e-05
ependymoma -1.600 1.9e-02
glioblastoma -1.100 8.1e-06
group 3 medulloblastoma -1.600 3.0e-02
interstitial cystitis -1.400 1.2e-02
lung adenocarcinoma -1.100 7.9e-15
medulloblastoma, large-cell -3.500 2.7e-07
oligodendroglioma -1.100 4.5e-02
Pick disease -1.200 3.8e-03
primitive neuroectodermal tumor -1.700 4.2e-02
psoriasis -1.200 5.3e-18
subependymal giant cell astrocytoma -2.109 5.7e-03

Gene RIF (3)

AA Sequence

MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQTSLLTNLHCFQPDVSGFSVSLAGTVACIHWETSQ      1 - 70
LSGLPEFVKIVEVGPRDGLQNEKVIVPTDIKIEFINRLSQTGLSVIEVTSFVSSRWVPQMADHTEVMKGI     71 - 140
HQYPGVRYPVLTPNLQGFHHAVAAGATEISVFGAASESFSKKNINCSIEESMGKFEEVVKSARHMNIPAR    141 - 210
GYVSCALGCPYEGSITPQKVTEVSKRLYGMGCYEISLGDTIGVGTPGSMKRMLESVMKEIPPGALAVHCH    211 - 280
DTYGQALANILTALQMGINVVDSAVSGLGGCPYAKGASGNVATEDLIYMLNGLGLNTGVNLYKVMEAGDF    281 - 350
ICKAVNKTTNSKVAQASFNA                                                      351 - 370
//

Text Mined References (13)

PMID Year Title