Property Summary

NCBI Gene PubMed Count 8
Grant Count 6
R01 Count 1
Funding $2,147,358
PubMed Score 231.49
PubTator Score 14.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 2.055 0.047
malignant mesothelioma -4.600 0.000
medulloblastoma, large-cell 1.100 0.002
non-small cell lung cancer -2.820 0.000
colon cancer -2.300 0.015
lung cancer -4.300 0.000
pancreatic cancer 1.100 0.001
interstitial cystitis -2.600 0.000
lung adenocarcinoma -1.800 0.000
lung carcinoma -5.000 0.000
ovarian cancer -3.000 0.000
pituitary cancer -3.900 0.000
psoriasis -1.300 0.000

Gene RIF (5)

PMID Text
24706764 NDNF acts as an endogenous modulator that promotes endothelial cell function and ischemia-induced revascularization through eNOS-dependent mechanisms
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of neuron-derived neurotrophic factor (NDNF; C4orf31) in primary human brain microvascular endothelial cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20332099 Observational study of gene-disease association. (HuGE Navigator)
16970039 direct duplication of chromosome 4q27q31.3 de novo results in partial trisomy of its long arm.

AA Sequence

MVLLHWCLLWLLFPLSSRTQKLPTRDEELFQMQIRDKAFFHDSSVIPDGAEISSYLFRDTPKRYFFVVEE      1 - 70
DNTPLSVTVTPCDAPLEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINEEGTELFSYKGNDVEYFISSS     71 - 140
SPSGLYQLDLLSTEKDTHFKVYATTTPESDQPYPELPYDPRVDVTSLGRTTVTLAWKPSPTASLLKQPIQ    141 - 210
YCVVINKEHNFKSLCAVEAKLSADDAFMMAPKPGLDFSPFDFAHFGFPSDNSGKERSFQAKPSPKLGRHV    211 - 280
YSRPKVDIQKICIGNKNIFTVSDLKPDTQYYFDVFVVNINSNMSTAYVGTFARTKEEAKQKTVELKDGKI    281 - 350
TDVFVKRKGAKFLRFAPVSSHQKVTFFIHSCLDAVQIQVRRDGKLLLSQNVEGIQQFQLRGKPKAKYLVR    351 - 420
LKGNKKGASMLKILATTRPTKQSFPSLPEDTRIKAFDKLRTCSSATVAWLGTQERNKFCIYKKEVDDNYN    421 - 490
EDQKKREQNQCLGPDIRKKSEKVLCKYFHSQNLQKAVTTETIKGLQPGKSYLLDVYVIGHGGHSVKYQSK    491 - 560
VVKTRKFC                                                                  561 - 568
//

Text Mined References (10)

PMID Year Title
24706764 2014 Neuron-derived neurotrophic factor functions as a novel modulator that enhances endothelial cell function and revascularization processes.
20969804 2010 Spatio-temporal expression of a novel neuron-derived neurotrophic factor (NDNF) in mouse brains during development.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
16970039 2006 Mosaicism for terminal deletion of 4q.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.