Property Summary

NCBI Gene PubMed Count 8
PubMed Score 249.24
PubTator Score 14.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
colon cancer -1.300 2.1e-02
interstitial cystitis -1.900 1.8e-03
lung adenocarcinoma -1.200 3.7e-06
lung cancer -2.800 2.0e-06
lung carcinoma -5.000 2.0e-44
malignant mesothelioma -4.600 4.2e-09
medulloblastoma, large-cell 1.100 2.0e-03
Multiple myeloma 2.055 4.7e-02
non-small cell lung cancer -2.820 7.6e-16
ovarian cancer -3.000 1.2e-12
pancreatic cancer 1.100 1.3e-03
pituitary cancer -3.900 1.3e-09
psoriasis -1.300 5.4e-43

Gene RIF (5)

AA Sequence

MVLLHWCLLWLLFPLSSRTQKLPTRDEELFQMQIRDKAFFHDSSVIPDGAEISSYLFRDTPKRYFFVVEE      1 - 70
DNTPLSVTVTPCDAPLEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINEEGTELFSYKGNDVEYFISSS     71 - 140
SPSGLYQLDLLSTEKDTHFKVYATTTPESDQPYPELPYDPRVDVTSLGRTTVTLAWKPSPTASLLKQPIQ    141 - 210
YCVVINKEHNFKSLCAVEAKLSADDAFMMAPKPGLDFSPFDFAHFGFPSDNSGKERSFQAKPSPKLGRHV    211 - 280
YSRPKVDIQKICIGNKNIFTVSDLKPDTQYYFDVFVVNINSNMSTAYVGTFARTKEEAKQKTVELKDGKI    281 - 350
TDVFVKRKGAKFLRFAPVSSHQKVTFFIHSCLDAVQIQVRRDGKLLLSQNVEGIQQFQLRGKPKAKYLVR    351 - 420
LKGNKKGASMLKILATTRPTKQSFPSLPEDTRIKAFDKLRTCSSATVAWLGTQERNKFCIYKKEVDDNYN    421 - 490
EDQKKREQNQCLGPDIRKKSEKVLCKYFHSQNLQKAVTTETIKGLQPGKSYLLDVYVIGHGGHSVKYQSK    491 - 560
VVKTRKFC                                                                  561 - 568
//

Text Mined References (10)

PMID Year Title