Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
astrocytoma 1493 2.48290165985372E-14
oligodendroglioma 2849 2.85074784952831E-13
glioblastoma 5572 3.50006493684641E-4
group 4 medulloblastoma 1875 4.5114763085609E-4
pediatric high grade glioma 2712 0.0121363835381298
primitive neuroectodermal tumor 3031 0.0165184355598685

Synonym

Accession Q8TB33 Q5H9B1
Symbols CXorf24

Gene

 Compartment GO Term (1)

AA Sequence

MGALFRLLLQERGKAAEFYSRGRKQRRPSASCTFGGIWSSGVDMLPNGAVGSLTQLGPSRPVLGIDYSKK      1 - 70
EFRGTAENVTGLNTILHFRKRTRS                                                   71 - 94
//

Text Mined References (3)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.