Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.100 2.5e-14
glioblastoma 1.100 3.5e-04
group 3 medulloblastoma 2.000 1.3e-02
oligodendroglioma 1.100 2.9e-13
pediatric high grade glioma 1.100 1.2e-02
primitive neuroectodermal tumor 1.300 1.7e-02

Synonym

Accession Q8TB33 Q5H9B1
Symbols CXorf24

 Compartment GO Term (1)

AA Sequence

MGALFRLLLQERGKAAEFYSRGRKQRRPSASCTFGGIWSSGVDMLPNGAVGSLTQLGPSRPVLGIDYSKK      1 - 70
EFRGTAENVTGLNTILHFRKRTRS                                                   71 - 94
//

Text Mined References (3)

PMID Year Title