Property Summary

NCBI Gene PubMed Count 22
PubMed Score 18.72
PubTator Score 8.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Osteitis Deformans 11 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Paget's disease of bone 36 4.074 2.0
Kidney disease 430 0.0 0.8

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.097 1.2e-02
astrocytoma 1.600 5.0e-03
Astrocytoma, Pilocytic 1.100 1.5e-04
COPD -1.300 6.2e-03
gastric carcinoma 1.200 1.4e-02
glioblastoma 1.400 1.8e-02
lung carcinoma -1.100 5.5e-20
malignant mesothelioma -1.500 3.3e-06
non-small cell lung cancer -1.046 6.3e-14
osteosarcoma -1.952 1.5e-05

Gene RIF (9)

AA Sequence

MIRHAGAPARGDPTGPVPVVGKGEEEEEEDGMRLCLPANPKNCLPHRRGISILEKLIKTCPVWLQLSLGQ      1 - 70
AEVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSALVFEDIFRLI     71 - 140
AFYCVSRDLLPFTLRLPQAILEASSFTDLETIANLGLGFWDSSLNPPQERGKPAEPPRDRAPGFPLVSSL    141 - 210
RPTAHDANCACEIELSVGNDRLWFVNPIFIEDCSSALPTDQPPLGNCPARPLPPTSDATSPTSRWAPRRP    211 - 280
PPPPPVLPLQPCSPAQPPVLPALAPAPACPLPTSPPVPAPHVTPHAPGPPDHPNQPPMMTCERLPCPTAG    281 - 350
LGPLREEAMKPGAASSPLQQVPAPPLPAKKNLPTAPPRRRVSERVSLEDQSPGMAAEGDQLSLPPQGTSD    351 - 420
GPEDTPRESTEQGQDTEVKASDPHSMPELPRTAKQPPVPPPRKKRISRQLASTLPAPLENAELCTQAMAL    421 - 490
ETPTPGPPREGQSPASQAGTQHPPAQATAHSQSSPEFKGSLASLSDSLGVSVMATDQDSYSTSSTEEELE    491 - 560
QFSSPSVKKKPSMILGKARHRLSFASFSSMFHAFLSNNRKLYKKVVELAQDKGSYFGSLVQDYKVYSLEM    561 - 630
MARQTSSTEMLQEIRTMMTQLKSYLLQSTELKALVDPALHSEEELEAIVESALYKCVLKPLKEAINSCLH    631 - 700
QIHSKDGSLQQLKENQLVILATTTTDLGVTTSVPEVPMMEKILQKFTSMHKAYSPEKKISILLKTCKLIY    701 - 770
DSMALGNPGKPYGADDFLPVLMYVLARSNLTEMLLNVEYMMELMDPALQLGEGSYYLTTTYGALEHIKSY    771 - 840
DKITVTRQLSVEVQDSIHRWERRRTLNKARASRSSVQDFICVSYLEPEQQARTLASRADTQAQALCAQCA    841 - 910
EKFAVERPQAHRLFVLVDGRCFQLADDALPHCIKGYLLRSEPKRDFHFVYRPLDGGGGGGGGSPPCLVVR    911 - 980
EPNFL                                                                     981 - 985
//

Text Mined References (22)

PMID Year Title