Property Summary

NCBI Gene PubMed Count 21
Grant Count 4
R01 Count 4
Funding $250,407
PubMed Score 17.82
PubTator Score 8.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
osteosarcoma -1.952 0.000
astrocytoma 1.600 0.005
glioblastoma 1.400 0.018
non-small cell lung cancer -1.196 0.000
pilocytic astrocytoma 1.100 0.000
aldosterone-producing adenoma -1.097 0.012
COPD -1.300 0.006
lung carcinoma -1.100 0.000
gastric carcinoma 1.200 0.014

Gene RIF (8)

PMID Text
26296892 discovered novel interaction candidates for CD2AP and characterized subtle yet significant differences in the recognition preferences of its three SH3 domains for c-CBL, ALIX, and RIN3
25701875 RIN3 may contribute to Paget's disease of bone susceptibility by affecting osteoclast function.
24945404 The study reports a novel association between a variant within RIN3 and lower limb-bone mineral density and note its previous association with risk of Paget's disease.
23185384 RIN3 is a negative regulator of mast cell responses to SCF
21586568 RIN3 specifically acts as a GEF for Rab31.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18486601 Tyrosine-phosphorylation signals are involved in the RIN3 activation and translocation to early endocytic vesicles.
12972505 RIN3 biochemically characterized as the stimulator and stabilizer for GTP-Rab5 plays an important role in the transport pathway from plasma membrane to early endosomes

AA Sequence

MIRHAGAPARGDPTGPVPVVGKGEEEEEEDGMRLCLPANPKNCLPHRRGISILEKLIKTCPVWLQLSLGQ      1 - 70
AEVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSALVFEDIFRLI     71 - 140
AFYCVSRDLLPFTLRLPQAILEASSFTDLETIANLGLGFWDSSLNPPQERGKPAEPPRDRAPGFPLVSSL    141 - 210
RPTAHDANCACEIELSVGNDRLWFVNPIFIEDCSSALPTDQPPLGNCPARPLPPTSDATSPTSRWAPRRP    211 - 280
PPPPPVLPLQPCSPAQPPVLPALAPAPACPLPTSPPVPAPHVTPHAPGPPDHPNQPPMMTCERLPCPTAG    281 - 350
LGPLREEAMKPGAASSPLQQVPAPPLPAKKNLPTAPPRRRVSERVSLEDQSPGMAAEGDQLSLPPQGTSD    351 - 420
GPEDTPRESTEQGQDTEVKASDPHSMPELPRTAKQPPVPPPRKKRISRQLASTLPAPLENAELCTQAMAL    421 - 490
ETPTPGPPREGQSPASQAGTQHPPAQATAHSQSSPEFKGSLASLSDSLGVSVMATDQDSYSTSSTEEELE    491 - 560
QFSSPSVKKKPSMILGKARHRLSFASFSSMFHAFLSNNRKLYKKVVELAQDKGSYFGSLVQDYKVYSLEM    561 - 630
MARQTSSTEMLQEIRTMMTQLKSYLLQSTELKALVDPALHSEEELEAIVESALYKCVLKPLKEAINSCLH    631 - 700
QIHSKDGSLQQLKENQLVILATTTTDLGVTTSVPEVPMMEKILQKFTSMHKAYSPEKKISILLKTCKLIY    701 - 770
DSMALGNPGKPYGADDFLPVLMYVLARSNLTEMLLNVEYMMELMDPALQLGEGSYYLTTTYGALEHIKSY    771 - 840
DKITVTRQLSVEVQDSIHRWERRRTLNKARASRSSVQDFICVSYLEPEQQARTLASRADTQAQALCAQCA    841 - 910
EKFAVERPQAHRLFVLVDGRCFQLADDALPHCIKGYLLRSEPKRDFHFVYRPLDGGGGGGGGSPPCLVVR    911 - 980
EPNFL                                                                     981 - 985
//

Text Mined References (21)

PMID Year Title
26296892 2015 Differential Recognition Preferences of the Three Src Homology 3 (SH3) Domains from the Adaptor CD2-associated Protein (CD2AP) and Direct Association with Ras and Rab Interactor 3 (RIN3).
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25701875 2015 Targeted sequencing of the Paget's disease associated 14q32 locus identifies several missense coding variants in RIN3 that predispose to Paget's disease of bone.
25101718 2015 IREB2 and GALC are associated with pulmonary artery enlargement in chronic obstructive pulmonary disease.
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24621683 2014 Risk loci for chronic obstructive pulmonary disease: a genome-wide association study and meta-analysis.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
23185384 2012 RIN3 is a negative regulator of mast cell responses to SCF.
21623375 2011 Genome-wide association identifies three new susceptibility loci for Paget's disease of bone.
More...