Property Summary

NCBI Gene PubMed Count 47
Grant Count 5
R01 Count 5
Funding $578,981.59
PubMed Score 29.84
PubTator Score 30.30

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

PMID Text
26484354 Based on our results and published findings on GSDMA, GSDMB, LRRC3C, and related proteins, we propose that this locus in part affects IBD susceptibility via effects on apoptosis and cell proliferation
26270739 GSDMB variants have been shown to be associated with Asthma in children with Rhinovirus infections -induced wheezing illnesses.
26016667 The GSDMB-driven HSVtk expression vector had a therapeutic effect on the occult peritoneal dissemination model mice.
25256354 Results confirmed the genetic association between GSDMB/ ORMDL3 and childhood asthma and show significant differences in the DNA methylation levels of ORMDL3 promoter of asthmatic children.
24848122 No association between GSDMB polymorphisms and rheumatoid arthritis was observed.
24675552 Gasdermin-B promotes invasion and metastasis in breast cancer cells
24315451 3 SNPs associated with the fraction of exhaled nitric oxide in childhood asthma are rs3751972 in LYRM9; rs944722 in NOS2; and rs8069176 near GSDMB; all at 17q12-q21.
24066901 GSDMB SNP rs2305480 (Ser311Pro) was associated with asthma diagnosis (p = 8.9x10-4), bronchial hyperresponsiveness to methacholine (p = 8.2x10-4) and severity (p = 1.5x10-4) with supporting evidence from a second GSDMB SNP rs11078927 (intronic).
24044605 rs11078928 is associated with the production of a novel GSDMB transcript lacking an internal segment
22732088 GSDMB/ORMDL3 variants contribute to asthma susceptibility and eosinophil-mediated bronchial hyperresponsiveness.
More...

AA Sequence

MFSVFEEITRIVVKEMDAGGDMIAVRSLVDADRFRCFHLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWL      1 - 70
DELDSGLQGQKAEFQILDNVDSTGELIVRLPKEITISGSFQGFHHQKIKISENRISQQYLATLENRKLKR     71 - 140
ELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVTIPPNRVLSYRVK    141 - 210
QLVFPNKETMSAGLDIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLG    211 - 280
KEDIRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEAL    281 - 350
EKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVVVSILLELAEGPTSVSS             351 - 411
//

Text Mined References (54)

PMID Year Title
27281216 2016 Pore-forming activity and structural autoinhibition of the gasdermin family.
26484354 2015 Gene Expression-Genotype Analysis Implicates GSDMA, GSDMB, and LRRC3C as Contributors to Inflammatory Bowel Disease Susceptibility.
26270739 2015 Rhinovirus in the Pathogenesis and Clinical Course of Asthma.
26016667 2015 A GSDMB enhancer-driven HSV thymidine kinase-expressing vector for controlling occult peritoneal dissemination of gastric cancer cells.
25256354 2015 Risk of childhood asthma is associated with CpG-site polymorphisms, regional DNA methylation and mRNA levels at the GSDMB/ORMDL3 locus.
24848122 Lack of association of the GSDMB gene at locus 17q12 with predisposition to rheumatoid arthritis.
24675552 2014 Gasdermin-B promotes invasion and metastasis in breast cancer cells.
24315451 2014 Fraction of exhaled nitric oxide values in childhood are associated with 17q11.2-q12 and 17q12-q21 variants.
24241537 2014 A genome-wide association study identifies CDHR3 as a susceptibility locus for early childhood asthma with severe exacerbations.
24066901 2013 Defining the contribution of SNPs identified in asthma GWAS to clinical variables in asthmatic children.
More...