Property Summary

NCBI Gene PubMed Count 54
PubMed Score 35.00
PubTator Score 30.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (34)

AA Sequence

MFSVFEEITRIVVKEMDAGGDMIAVRSLVDADRFRCFHLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWL      1 - 70
DELDSGLQGQKAEFQILDNVDSTGELIVRLPKEITISGSFQGFHHQKIKISENRISQQYLATLENRKLKR     71 - 140
ELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVTIPPNRVLSYRVK    141 - 210
QLVFPNKETMSAGLDIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLG    211 - 280
KEDIRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEAL    281 - 350
EKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVVVSILLELAEGPTSVSS             351 - 411
//

Text Mined References (61)

PMID Year Title