Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 3.20730245097408E-14
malignant mesothelioma 3163 1.14963200786636E-7
osteosarcoma 7933 1.24750361824309E-5

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -2.200 0.000
osteosarcoma -1.531 0.000
ovarian cancer -1.500 0.000

Synonym

Accession Q8TAW3 A6NF07 Q9H5E9
Symbols

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Horse OMA EggNOG
Pig OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
26320192 Data show that ZNF671, an epigenetically silenced tumor suppressor, represents a potential predictor for urothelial carcinoma (UC) relapse and non-invasive biomarker that could assist in UC clinical decision-making.

AA Sequence

MLSPVSRDASDALQGRKCLRPRSRRLPLPAAVRAHGPMAELTDSARGCVVFEDVFVYFSREEWELLDDAQ      1 - 70
RLLYHDVMLENFALLASLGIAFSRSRAVMKLERGEEPWVYDQVDMTSATEREAQRGLRPGCWHGVEDEEV     71 - 140
SSEQSIFVAGVSEVRTLMAELESHPCDICGPILKDTLHLAKYHGGKARQKPYLCGACGKQFWFSTDFDQH    141 - 210
QNQPNGGKLFPRKEGRDSVKSCRVHVPEKTLTCGKGRRDFSATSGLLQHQASLSSMKPHKSTKLVSGFLM    211 - 280
GQRYHRCGECGKAFTRKDTLARHQRIHTGERPYECNECGKFFSQSYDLFKHQTVHTGERPYECSECGKFF    281 - 350
RQISGLIEHRRVHTGERLYQCGKCGKFFSSKSNLIRHQEVHTGARPYVCSECGKEFSRKHTLVLHQRTHT    351 - 420
GERPYECSECGKAFSQSSHLNVHWRIHSSDYECSRCGKAFSCISKLIQHQKVHSGEKPYECSKCGKAFTQ    421 - 490
RPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKL                              491 - 534
//

Text Mined References (7)

PMID Year Title
26320192 2015 Methylomics analysis identifies ZNF671 as an epigenetically repressed novel tumor suppressor and a potential non-invasive biomarker for the detection of urothelial carcinoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.