Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 3.2e-14
malignant mesothelioma 3232 1.1e-07
osteosarcoma 7950 1.2e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -2.200 1.1e-07
osteosarcoma -1.531 1.2e-05
ovarian cancer -1.500 3.2e-14

Gene RIF (1)

AA Sequence

MLSPVSRDASDALQGRKCLRPRSRRLPLPAAVRAHGPMAELTDSARGCVVFEDVFVYFSREEWELLDDAQ      1 - 70
RLLYHDVMLENFALLASLGIAFSRSRAVMKLERGEEPWVYDQVDMTSATEREAQRGLRPGCWHGVEDEEV     71 - 140
SSEQSIFVAGVSEVRTLMAELESHPCDICGPILKDTLHLAKYHGGKARQKPYLCGACGKQFWFSTDFDQH    141 - 210
QNQPNGGKLFPRKEGRDSVKSCRVHVPEKTLTCGKGRRDFSATSGLLQHQASLSSMKPHKSTKLVSGFLM    211 - 280
GQRYHRCGECGKAFTRKDTLARHQRIHTGERPYECNECGKFFSQSYDLFKHQTVHTGERPYECSECGKFF    281 - 350
RQISGLIEHRRVHTGERLYQCGKCGKFFSSKSNLIRHQEVHTGARPYVCSECGKEFSRKHTLVLHQRTHT    351 - 420
GERPYECSECGKAFSQSSHLNVHWRIHSSDYECSRCGKAFSCISKLIQHQKVHSGEKPYECSKCGKAFTQ    421 - 490
RPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKL                              491 - 534
//

Text Mined References (7)

PMID Year Title