Property Summary

NCBI Gene PubMed Count 38
Grant Count 19
R01 Count 16
Funding $1,706,999.98
PubMed Score 30.60
PubTator Score 17.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (26)

PMID Text
24473197 The persons with a NKX2-3 G or T allele may have a moderately increased risk of CD.
22377701 A positive correlation was observed between mRNA expression of PTPN2 and NKX2-3 in B cells and in intestinal tissues from both Crohn's disease and ulcerative colitis patients.
21968973 NKX2-3 may play different roles in ulcerative colitis and Crohn's disease pathogenesis by differential regulation of EGR1.
21803625 The binding of NFAT1 to the NKX2-3 promoter region with rs1190140 was confirmed by chromatin immunoprecipitation assay.
21637825 NKX2-3 may play an important role in inflammatory bowel disease pathogenesis by regulating endothelin-1 and VEGF signaling in human intestinal microvascular endothelial cells.
21514341 the risk haplotype of NKX2.3 confers susceptibility to UC through increasing expression of NKX2.3 mRNA in the colonic mucosa.
21072187 Observational study of gene-disease association. (HuGE Navigator)
21049557 Data suggest that NKX2-3 and IRGM are susceptibility loci for inflammatory bowel disease in Eastern European patients.
21049557 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKL      1 - 70
SYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEES     71 - 140
ERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQRQDK    141 - 210
SLELGAHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAAAAAAAAA    211 - 280
AAAAAAYSSSYGCAYPAGGGGGGGGTSAATTAMQPACSAAGGGPFVNVSNLGGFGSGGSAQPLHQGTAAG    281 - 350
AACAQGTLQGIRAW                                                            351 - 364
//

Text Mined References (39)

PMID Year Title
24737748 2014 Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis.
24473197 2014 Contribution of NKX2-3 polymorphisms to inflammatory bowel diseases: a meta-analysis of 35358 subjects.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22377701 2012 PTPN2 is associated with Crohn's disease and its expression is regulated by NKX2-3.
21968973 2012 Genes differentially regulated by NKX2-3 in B cells between ulcerative colitis and Crohn's disease patients and possible involvement of EGR1.
21803625 NKX2-3 variant rs11190140 is associated with IBD and alters binding of NFAT.
21637825 2011 NKX2-3 transcriptional regulation of endothelin-1 and VEGF signaling in human intestinal microvascular endothelial cells.
More...