Property Summary

NCBI Gene PubMed Count 39
PubMed Score 30.67
PubTator Score 17.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

AA Sequence

MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKL      1 - 70
SYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEES     71 - 140
ERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQRQDK    141 - 210
SLELGAHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAAAAAAAAA    211 - 280
AAAAAAYSSSYGCAYPAGGGGGGGGTSAATTAMQPACSAAGGGPFVNVSNLGGFGSGGSAQPLHQGTAAG    281 - 350
AACAQGTLQGIRAW                                                            351 - 364
//

Text Mined References (40)

PMID Year Title