Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 7.2e-06
osteosarcoma 7950 2.9e-04
group 3 medulloblastoma 4104 3.4e-03

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.400 3.4e-03
osteosarcoma -1.052 2.9e-04
ovarian cancer 1.500 7.2e-06

Synonym

Accession Q8TAP8 A4D2C5
Symbols C7orf47

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MMMGCGESELKSADGEEAAAVPGPPPEPQVPQLRAPVPEPGLDLSLSPRPDSPQPRHGSPGRRKGRAERR      1 - 70
GAARQRRQVRFRLTPPSPVRSEPQPAVPQELEMPVLKSSLALGLELRAAAGSHFDAAKAVEEQLRKSFQI     71 - 140
RCGLEESVSEGLNVPRSKRLFRDLVSLQVPEEQVLNAALREKLALLPPQARAPHPKEPPGPGPDMTILCD    141 - 210
PETLFYESPHLTLDGLPPLRLQLRPRPSEDTFLMHRTLRRWEA                               211 - 253
//

Text Mined References (10)

PMID Year Title