Property Summary

NCBI Gene PubMed Count 21
PubMed Score 1.80
PubTator Score 2.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
aldosterone-producing adenoma -1.314 5.3e-03
hepatocellular carcinoma 1.300 3.8e-05
lung cancer 1.600 2.3e-03
malignant mesothelioma 1.900 9.1e-08
non-small cell lung cancer 1.137 5.4e-12
ovarian cancer 1.300 8.1e-03
psoriasis 1.100 2.8e-03
subependymal giant cell astrocytoma -1.388 3.0e-02
tuberculosis -1.400 8.3e-06

Synonym

Accession Q8TAP6 B0YJB2 B4DXG5 B4DZW1 Q658N5 Q9H9U7 Cep76
Symbols C18orf9
HsT1705

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 IMPC Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MSLPPEKASELKQLIHQQLSKMDVHGRIREILAETIREELAPDQQHLSTEDLIKALRRRGIIDDVMKELN      1 - 70
FVTDSVEQELPSSPKQPICFDRQSTLKKTNIDPTRRYLYLQVLGGKAFLEHLQEPEPLPGQVCSTFTLCL     71 - 140
HYRNQRFRSKPVPCACEPDFHDGFLLEVHRESLGDGTRMADSTTMLSISDPIHMVLIKTDIFGETTLVAS    141 - 210
YFLEWRSVLGSENGVTSLTVELMGVGTESKVSVGILNIKLEMYPPLNQTLSQEVVNTQLALERQKTAEKE    211 - 280
RLFLVYAKQWWREYLQIRPSHNSRLVKIFAQDENGINRPVCSYVKPLRAGRLLDTPRQAARFVNVLGYER    281 - 350
APVIGGGGKQEQWCTLLAFLCRNKGDCEDHANLLCSLLLGYGLEAFVCVGTKAKGVPHAWVMTCGTDGAI    351 - 420
TFWESLTGHRYIHKPTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKP    421 - 490
MSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWEDQLSYLLSPA    491 - 560
LASYEFERTTSISAGNEEFQDAIRRAVPDGHTFKGFPIHFVYRNARRAFATCLRSPFCEEIICCRGDQVR    561 - 630
LAVRVRVFTYPESACAVWIMFACKYRSVL                                             631 - 659
//

Text Mined References (26)

PMID Year Title