Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.40
PubTator Score 1.40

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
19834535 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVFLKFFCMSFFCHLCQGYFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGS      1 - 70
QVGSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTEL     71 - 140
ESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLALTIRSHGTRLGRLKNDYLK    141 - 210
V//

Text Mined References (7)

PMID Year Title
21615908 2011 Characterization of the expression, promoter activity and molecular architecture of fibin.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
17196583 2007 Fibin, a novel secreted lateral plate mesoderm signal, is essential for pectoral fin bud initiation in zebrafish.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.