Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.40
PubTator Score 1.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 5.16622844299752E-51
non-small cell lung carcinoma 413 4.75800011184745E-25
lung carcinoma 2844 9.54056006660611E-14
lung adenocarcinoma 2714 7.09805014710049E-13
astrocytoma 1493 7.60295736364552E-10
pilocytic astrocytoma 3086 2.66667342543368E-8
oligodendroglioma 2849 2.73896932527092E-6
glioblastoma 5572 3.24492366575464E-5
group 4 medulloblastoma 1875 3.92591488677143E-5
Atopic dermatitis 944 8.34321168412878E-5
adult high grade glioma 2148 8.49217204492825E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.45329097775535E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.26326447686967E-4
osteosarcoma 7933 3.32608991993295E-4
ovarian cancer 8492 4.72328442446097E-4
posterior fossa group B ependymoma 1530 6.14320105168213E-4
Breast cancer 3099 0.00119219589277209
cystic fibrosis 1670 0.00132345861212091
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00408440832114564
adrenocortical carcinoma 1427 0.00467296161449761
invasive ductal carcinoma 2950 0.00557205350763213
atypical teratoid / rhabdoid tumor 4369 0.0087661275105015
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0177623847771884
pancreatic cancer 2300 0.0303430394607835
interstitial cystitis 2299 0.0314536977367455
X-linked cerebral adrenoleukodystrophy 115 0.0453381053150028

Expression

Synonym

Accession Q8TAL6
Symbols

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
19834535 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVFLKFFCMSFFCHLCQGYFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGS      1 - 70
QVGSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTEL     71 - 140
ESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLALTIRSHGTRLGRLKNDYLK    141 - 210
V//

Text Mined References (7)

PMID Year Title
21615908 2011 Characterization of the expression, promoter activity and molecular architecture of fibin.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
17196583 2007 Fibin, a novel secreted lateral plate mesoderm signal, is essential for pectoral fin bud initiation in zebrafish.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.