Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.85
PubTator Score 1.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma -1.372 4.7e-03
adult high grade glioma 1.500 3.7e-04
astrocytoma 1.400 7.6e-10
Astrocytoma, Pilocytic 2.000 2.9e-08
Atopic dermatitis -2.100 8.3e-05
atypical teratoid / rhabdoid tumor -1.600 8.8e-03
autosomal dominant Emery-Dreifuss muscul... 1.044 4.1e-03
Breast cancer -1.300 1.2e-03
cystic fibrosis -1.500 1.3e-03
glioblastoma 1.400 2.9e-04
group 3 medulloblastoma -1.700 1.7e-03
interstitial cystitis 1.300 3.1e-02
intraductal papillary-mucinous adenoma (... -3.300 2.3e-04
intraductal papillary-mucinous carcinoma... -3.400 1.5e-04
intraductal papillary-mucinous neoplasm ... -2.600 1.8e-02
invasive ductal carcinoma 1.523 5.6e-03
lung adenocarcinoma -2.000 7.1e-13
lung carcinoma -2.700 9.5e-14
non-small cell lung cancer -1.801 1.0e-08
oligodendroglioma 1.200 2.7e-06
osteosarcoma 3.073 3.9e-03
ovarian cancer -1.300 8.9e-03
pancreatic cancer 1.500 3.0e-02
posterior fossa group B ependymoma 1.100 6.1e-04
psoriasis -1.200 4.3e-19
X-linked cerebral adrenoleukodystrophy 1.600 4.5e-02

Gene RIF (1)

AA Sequence

MVFLKFFCMSFFCHLCQGYFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGS      1 - 70
QVGSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTEL     71 - 140
ESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLALTIRSHGTRLGRLKNDYLK    141 - 210
V//

Text Mined References (7)

PMID Year Title