Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.05

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -3.700 2.3e-03
astrocytic glioma -1.500 1.4e-02
Astrocytoma, Pilocytic -2.600 4.5e-05
atypical teratoid / rhabdoid tumor -3.500 1.8e-08
Breast cancer 1.200 4.6e-02
ependymoma -1.500 2.8e-02
gastric carcinoma -1.100 8.7e-03
glioblastoma -2.000 2.7e-04
interstitial cystitis -2.700 2.5e-04
medulloblastoma -1.700 1.8e-02
oligodendroglioma -1.800 1.6e-08
Pick disease -1.600 4.0e-02
primitive neuroectodermal tumor -2.700 5.2e-03
psoriasis -1.800 1.5e-10

Gene RIF (1)

AA Sequence

MMGIFLVYVGFVFFSVLYVQQGLSSQAKFTEFPRNVTATEGQNVEMSCAFQSGSASVYLEIQWWFLRGPE      1 - 70
DLDPGAEGAGAQVELLPDRDPDSDGTKISTVKVQGNDISHKLQISKVRKKDEGLYECRVTDANYGELQEH     71 - 140
KAQAYLKVNANSHARRMQAFEASPMWLQDMKPRKNVSAAIPSSIHGSANQRTHSTSSPQVVAKIPKQSPQ    141 - 210
SGARIATSHGLSVLLLVCGFVKGALL                                                211 - 236
//

Text Mined References (6)

PMID Year Title