Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.900 0.016
ependymoma -4.000 0.000
glioblastoma -5.100 0.000
oligodendroglioma -2.300 0.000
atypical teratoid / rhabdoid tumor -5.600 0.000
medulloblastoma -1.700 0.018
primitive neuroectodermal tumor -2.700 0.005
interstitial cystitis -4.300 0.000
pediatric high grade glioma -3.900 0.000
pilocytic astrocytoma -4.700 0.000
Pick disease -1.600 0.040
Breast cancer 1.200 0.046
gastric carcinoma -1.100 0.009
psoriasis -1.800 0.000

AA Sequence

MMGIFLVYVGFVFFSVLYVQQGLSSQAKFTEFPRNVTATEGQNVEMSCAFQSGSASVYLEIQWWFLRGPE      1 - 70
DLDPGAEGAGAQVELLPDRDPDSDGTKISTVKVQGNDISHKLQISKVRKKDEGLYECRVTDANYGELQEH     71 - 140
KAQAYLKVNANSHARRMQAFEASPMWLQDMKPRKNVSAAIPSSIHGSANQRTHSTSSPQVVAKIPKQSPQ    141 - 210
SGARIATSHGLSVLLLVCGFVKGALL                                                211 - 236
//

Text Mined References (5)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.