Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.47669307841645E-10
ependymoma 2514 1.82580678488584E-10
atypical teratoid / rhabdoid tumor 4369 4.6496763164153E-9
oligodendroglioma 2849 7.4754621966748E-9
interstitial cystitis 2299 7.19614219750465E-7
pilocytic astrocytoma 3086 1.06506541559042E-6
glioblastoma 5572 4.69184408961637E-5
pediatric high grade glioma 2712 1.03885104963207E-4
primitive neuroectodermal tumor 3031 0.00515415188397977
gastric carcinoma 832 0.00866713908666797
astrocytic glioma 2241 0.0164845830162193
medulloblastoma 1524 0.0181734638858645
Pick disease 1893 0.040127416774698
Breast cancer 3099 0.0455620256115452
Disease Target Count Z-score Confidence
Bone marrow cancer 4 0.0 1.0

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.900 0.016
ependymoma -4.000 0.000
glioblastoma -5.100 0.000
oligodendroglioma -2.300 0.000
atypical teratoid / rhabdoid tumor -5.600 0.000
medulloblastoma -1.700 0.018
primitive neuroectodermal tumor -2.700 0.005
interstitial cystitis -4.300 0.000
pediatric high grade glioma -3.900 0.000
pilocytic astrocytoma -4.700 0.000
Pick disease -1.600 0.040
Breast cancer 1.200 0.046
gastric carcinoma -1.100 0.009
psoriasis -1.800 0.000

Synonym

Accession Q8TAG5 A4D2E9 B5MC94
Symbols VSTM2

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

AA Sequence

MMGIFLVYVGFVFFSVLYVQQGLSSQAKFTEFPRNVTATEGQNVEMSCAFQSGSASVYLEIQWWFLRGPE      1 - 70
DLDPGAEGAGAQVELLPDRDPDSDGTKISTVKVQGNDISHKLQISKVRKKDEGLYECRVTDANYGELQEH     71 - 140
KAQAYLKVNANSHARRMQAFEASPMWLQDMKPRKNVSAAIPSSIHGSANQRTHSTSSPQVVAKIPKQSPQ    141 - 210
SGARIATSHGLSVLLLVCGFVKGALL                                                211 - 236
//

Text Mined References (5)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.