Property Summary

NCBI Gene PubMed Count 25
PubMed Score 20.06
PubTator Score 14.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 6.6e-07
malignant mesothelioma 3232 3.5e-06
ovarian cancer 8520 1.9e-05
group 4 medulloblastoma 1855 1.2e-03
psoriasis 6694 2.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Aplastic Anemia 21 4.533 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma 1.300 1.2e-03
malignant mesothelioma 1.500 3.5e-06
osteosarcoma -2.499 6.6e-07
ovarian cancer -1.400 1.9e-05
psoriasis -1.100 2.0e-03

Protein-protein Interaction (2)

Gene RIF (13)

AA Sequence

MAAHHRQNTAGRRKVQVSYVIRDEVEKYNRNGVNALQLDPALNRLFTAGRDSIIRIWSVNQHKQDPYIAS      1 - 70
MEHHTDWVNDIVLCCNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYVKALAYAKDKELVASAGLDRQ     71 - 140
IFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQLGTIIVSGSTEKVLRVWDPRTCAKLMKLKGHT    141 - 210
DNVKALLLNRDGTQCLSGSSDGTIRLWSLGQQRCIATYRVHDEGVWALQVNDAFTHVYSGGRDRKIYCTD    211 - 280
LRNPDIRVLICEEKAPVLKMELDRSADPPPAIWVATTKSTVNKWTLKGIHNFRASGDYDNDCTNPITPLC    281 - 350
TQPDQVIKGGASIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWF    351 - 420
SVDLKTGMLTITLDESDCFAAWVSAKDAGFSSPDGSDPKLNLGGLLLQALLEYWPRTHVNPMDEEENEVN    421 - 490
HVNGEQENRVQKGNGYFQVPPHTPVIFGEAGGRTLFRLLCRDSGGETESMLLNETVPQWVIDITVDKNMP    491 - 560
KFNKIPFYLQPHASSGAKTLKKDRLSASDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPGEQEKEED    561 - 630
IAVLAEEKIELLCQDQVLDPNMDLRTVKHFIWKSGGDLTLHYRQKST                           631 - 677
//

Text Mined References (30)

PMID Year Title