Property Summary

NCBI Gene PubMed Count 21
Grant Count 75
R01 Count 60
Funding $8,710,294.01
PubMed Score 18.83
PubTator Score 14.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
psoriasis -1.100 0.002
osteosarcoma -2.499 0.000
group 4 medulloblastoma 1.300 0.001
ovarian cancer -1.400 0.000

Synonym

Accession Q8TAF3 B4DM86 B4DQI2 B4DY84 Q63HJ2 Q658Y1 Q8N3Z1 Q9NSK8 Q9P279
Symbols P80
UAF1
SPG60

Gene

PDB

5CVN   5CVO   5K1A   5K1B   5K1C   5CVL  

Gene RIF (9)

PMID Text
26758085 analysis of the function and regulation of the USP1-UAF1 complex
24850727 Coimmunoprecipitation experiments indicated that human papillomavirus type 31 E1 assembles into a ternary complex with UAF1 and any one of these three USPs: USP1, USP12 and USP46.
24145035 our results reveal WDR48 and USP12 as novel PHLPP1 regulators and potential suppressors of tumor cell survival.
23116119 Our findings revealed an intriguing mechanism of regulating USP1 activity that combines phosphorylation of a key serine residue in USP1 and the specific interaction of USP1 with a WD40-repeat protein UAF1
22701671 USP1 and UAF1 form a complex in the cytoplasm that subsequently translocates to the nucleus through import mediated by USP1 nuclear localization signals.
22278251 p80 is recruited to the viral origin in an E1- and E2-dependent manner.
20147737 WDR20 serves as a stimulatory subunit for preserving and regulating the activity of the subset of the UAF1 x USP12 complexes
19075014 two novel multisubunit deubiquitinating enzyme complexes containing USP12 and USP46, respectively. Both complexes contain the UAF1 protein as a bona fide subunit. Interestingly, UAF1
18032488 These findings suggest that the interaction of human papillomavirus 11 and 31 E1 proteins with p80 is required for efficient maintenance of the viral episome in undifferentiated keratinocytes.

AA Sequence

MAAHHRQNTAGRRKVQVSYVIRDEVEKYNRNGVNALQLDPALNRLFTAGRDSIIRIWSVNQHKQDPYIAS      1 - 70
MEHHTDWVNDIVLCCNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYVKALAYAKDKELVASAGLDRQ     71 - 140
IFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQLGTIIVSGSTEKVLRVWDPRTCAKLMKLKGHT    141 - 210
DNVKALLLNRDGTQCLSGSSDGTIRLWSLGQQRCIATYRVHDEGVWALQVNDAFTHVYSGGRDRKIYCTD    211 - 280
LRNPDIRVLICEEKAPVLKMELDRSADPPPAIWVATTKSTVNKWTLKGIHNFRASGDYDNDCTNPITPLC    281 - 350
TQPDQVIKGGASIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWF    351 - 420
SVDLKTGMLTITLDESDCFAAWVSAKDAGFSSPDGSDPKLNLGGLLLQALLEYWPRTHVNPMDEEENEVN    421 - 490
HVNGEQENRVQKGNGYFQVPPHTPVIFGEAGGRTLFRLLCRDSGGETESMLLNETVPQWVIDITVDKNMP    491 - 560
KFNKIPFYLQPHASSGAKTLKKDRLSASDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPGEQEKEED    561 - 630
IAVLAEEKIELLCQDQVLDPNMDLRTVKHFIWKSGGDLTLHYRQKST                           631 - 677
//

Text Mined References (26)

PMID Year Title
26758085 2016 Mutations in the 'Fingers' subdomain of the deubiquitinase USP1 modulate its function and activity.
26388029 2015 Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
24850727 2014 E1-mediated recruitment of a UAF1-USP deubiquitinase complex facilitates human papillomavirus DNA replication.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
24482476 2014 Exome sequencing links corticospinal motor neuron disease to common neurodegenerative disorders.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24145035 2013 WD repeat protein WDR48 in complex with deubiquitinase USP12 suppresses Akt-dependent cell survival signaling by stabilizing PH domain leucine-rich repeat protein phosphatase 1 (PHLPP1).
23116119 2012 Serine phosphorylation is critical for the activation of ubiquitin-specific protease 1 and its interaction with WD40-repeat protein UAF1.
22701671 2012 Two nuclear localization signals in USP1 mediate nuclear import of the USP1/UAF1 complex.
22278251 2012 Inhibition of human papillomavirus DNA replication by an E1-derived p80/UAF1-binding peptide.
More...