Property Summary

NCBI Gene PubMed Count 17
Grant Count 9
R01 Count 7
Funding $415,448.5
PubMed Score 24.30
PubTator Score 16.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
gastric cancer 1.200 0.001
hepatocellular carcinoma 1.500 0.000
Waldenstrons macroglobulinemia 1.059 0.015
Multiple myeloma 1.130 0.020
psoriasis -2.300 0.000
osteosarcoma -1.477 0.000
glioblastoma 1.200 0.018
atypical teratoid / rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell 1.300 0.000
acute quadriplegic myopathy 1.172 0.000
tuberculosis -1.300 0.000
active Crohn's disease 1.113 0.028
adult high grade glioma 1.300 0.003
group 4 medulloblastoma 1.100 0.001
primary Sjogren syndrome 1.100 0.011
lung adenocarcinoma 1.198 0.000
ovarian cancer 2.400 0.000

Gene RIF (10)

PMID Text
23275032 Overexpression of ZnT5 is accompanied by activation of PI3K/Akt pathway and inhibiting HG-induced apoptosis.
22529353 Results identify a unique class of transporters Znt5 and Znt8 and the structural motif required to discriminate between Zn(2+) and Cd(2+) transport.
21887337 exons 15 to 17 include a signal that results in trafficking of ZnT5 to the Golgi apparatus and that the 3' end of exon 14 includes a signal that leads to retention in the ER.
20689807 Observational study of gene-disease association. (HuGE Navigator)
19759014 The cytosolic C-terminal tail of ZnT5 is important for its interaction with ZnT6 as a heterodimer.
19064571 Observational study of gene-disease association. (HuGE Navigator)
18639746 Data show that ZNT5 is extensively present in the Abeta-positive plaques in the cortex of human AD brains.
17971500 hZnT-5 is up-regulated in response to cellular zinc depletion in Raji cells.
11937503 A novel zinc-regulated human zinc transporter, hZTL1, is localized to the enterocyte apical membrane
11904301 cloning and characterization of ZnT-5 which is expressed in pancreatic beta cells

AA Sequence

MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGT      1 - 70
AFFMVLFQKPFSSGKTITKHQWIKIFKHAVAGCIISLLWFFGLTLCGPLRTLLLFEHSDIVVISLLSVLF     71 - 140
TSSGGGPAKTRGAAFFIIAVICLLLFDNDDLMAKMAEHPEGHHDSALTHMLYTAIAFLGVADHKGGVLLL    141 - 210
VLALCCKVGFHTASRKLSVDVGGAKRLQALSHLVSVLLLCPWVIVLSVTTESKVESWFSLIMPFATVIFF    211 - 280
VMILDFYVDSICSVKMEVSKCARYGSFPIFISALLFGNFWTHPITDQLRAMNKAAHQESTEHVLSGGVVV    281 - 350
SAIFFILSANILSSPSKRGQKGTLIGYSPEGTPLYNFMGDAFQHSSQSIPRFIKESLKQILEESDSRQIF    351 - 420
YFLCLNLLFTFVELFYGVLTNSLGLISDGFHMLFDCSALVMGLFAALMSRWKATRIFSYGYGRIEILSGF    421 - 490
INGLFLIVIAFFVFMESVARLIDPPELDTHMLTPVSVGGLIVNLIGICAFSHAHSHAHGASQGSCHSSDH    491 - 560
SHSHHMHGHSDHGHGHSHGSAGGGMNANMRGVFLHVLADTLGSIGVIVSTVLIEQFGWFIADPLCSLFIA    561 - 630
ILIFLSVVPLIKDACQVLLLRLPPEYEKELHIALEKIQKIEGLISYRDPHFWRHSASIVAGTIHIQVTSD    631 - 700
VLEQRIVQQVTGILKDAGVNNLTIQVEKEAYFQHMSGLSTGFHDVLAMTKQMESMKYCKDGTYIM         701 - 765
//

Text Mined References (26)

PMID Year Title
25582195 2015 The zinc finger protein ZNF658 regulates the transcription of genes involved in zinc homeostasis and affects ribosome biogenesis through the zinc transcriptional regulatory element.
23275032 2013 Zinc transporter 5 and zinc transporter 7 induced by high glucose protects peritoneal mesothelial cells from undergoing apoptosis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22529353 2012 Histidine pairing at the metal transport site of mammalian ZnT transporters controls Zn2+ over Cd2+ selectivity.
21887337 2011 Differential subcellular localization of the splice variants of the zinc transporter ZnT5 is dictated by the different C-terminal regions.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19759014 2009 Demonstration and characterization of the heterodimerization of ZnT5 and ZnT6 in the early secretory pathway.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...