Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.900 0.007
ependymoma -2.600 0.010
oligodendroglioma -1.800 0.030
glioblastoma -1.800 0.000
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.000 0.001
primitive neuroectodermal tumor -2.600 0.005
lung cancer 1.100 0.002
active ulcerative colitis 1.216 0.004
adult high grade glioma -1.500 0.005
ovarian cancer 1.400 0.000

Synonym

Accession Q8TAB5 D3DPS1 Q8N8N6
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MFAIQPGLAEGGQFLGDPPPGLCQPELQPDSNSNFMASAKDANENWHGMPGRVEPILRRSSSESPSDNQA      1 - 70
FQAPGSPEEGVRSPPEGAEIPGAEPEKMGGAGTVCSPLEDNGYASSSLSIDSRSSSPEPACGTPRGPGPP     71 - 140
DPLLPSVAQAVQHLQVQERYKEQEKEKHHVHLVMYRRLALLQWIRGLQHQLIDQQARLQESFDTILDNRK    141 - 210
ELIRCLQQRAAPSRPQDQA                                                       211 - 229
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.