Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active ulcerative colitis 1.216 3.6e-03
adult high grade glioma -1.500 5.0e-03
astrocytic glioma -1.900 6.9e-03
atypical teratoid / rhabdoid tumor -2.100 2.1e-07
ependymoma -2.600 9.9e-03
glioblastoma -1.100 4.9e-04
lung cancer 1.100 1.9e-03
medulloblastoma -1.100 1.7e-03
medulloblastoma, large-cell -2.000 1.3e-03
oligodendroglioma -1.800 3.0e-02
ovarian cancer 1.400 1.4e-04
primitive neuroectodermal tumor -2.600 4.9e-03

AA Sequence

MFAIQPGLAEGGQFLGDPPPGLCQPELQPDSNSNFMASAKDANENWHGMPGRVEPILRRSSSESPSDNQA      1 - 70
FQAPGSPEEGVRSPPEGAEIPGAEPEKMGGAGTVCSPLEDNGYASSSLSIDSRSSSPEPACGTPRGPGPP     71 - 140
DPLLPSVAQAVQHLQVQERYKEQEKEKHHVHLVMYRRLALLQWIRGLQHQLIDQQARLQESFDTILDNRK    141 - 210
ELIRCLQQRAAPSRPQDQA                                                       211 - 229
//

Text Mined References (7)

PMID Year Title