Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.07
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.500 2.3e-02
atypical teratoid / rhabdoid tumor 1.400 3.9e-04
group 4 medulloblastoma 2.100 2.6e-04
medulloblastoma, large-cell 2.500 2.1e-06
osteosarcoma 1.298 1.8e-03

Synonym

Accession Q8TAA5 B4DFA6 Q49AJ6
Symbols Mt-GrpE#2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAVRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLE      1 - 70
KEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTL     71 - 140
EKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTI    141 - 210
RLARVEVAVESQRRL                                                           211 - 225
//

Text Mined References (12)

PMID Year Title