Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.68
PubTator Score 1.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.18698788112208E-52
non-small cell lung cancer 2798 7.34649687684192E-14
ovarian cancer 8492 1.87421759079124E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.85757783858589E-5
interstitial cystitis 2299 3.44837367795846E-5
pituitary cancer 1972 0.00184544315460909
chronic rhinosinusitis 512 0.00474353782991593
group 3 medulloblastoma 2254 0.00531873591521086
fibroadenoma 557 0.00718928252474602
active Crohn's disease 918 0.0242642164534912
Hydrolethalus syndrome 128 0.0448981561164823
Disease Target Count Z-score Confidence
Nicotine dependence 53 4.324 2.2

Expression

  Differential Expression (11)

Disease log2 FC p
non-small cell lung cancer 1.852 0.000
intraductal papillary-mucinous adenoma (... 2.200 0.000
Hydrolethalus syndrome 2.028 0.045
active Crohn's disease 1.072 0.024
fibroadenoma 1.200 0.007
interstitial cystitis -2.800 0.000
group 3 medulloblastoma -1.400 0.005
ovarian cancer 2.200 0.000
pituitary cancer 1.900 0.002
chronic rhinosinusitis -1.045 0.005
psoriasis -1.200 0.000

Synonym

Accession Q8NI32 D3DP90 Q53TK0 Q7Z747 Q8IXK7
Symbols CT116
LYPD7

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish EggNOG Inparanoid

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18360792 LYPD7 was especially highly expressed in testis, lung, stomach, and prostate.

AA Sequence

MLYKSSDRPAHKVSMLLLCHALAIAVVQIVIFSESWAFAKNINFYNVRPPLDPTPFPNSFKCFTCENAGD      1 - 70
NYNCNRWAEDKWCPQNTQYCLTVHHFTSHGRSTSITKKCASRSECHFVGCHHSRDSEHTECRSCCEGMIC     71 - 140
NVELPTNHTNAVFAVMHAQRTSGSSAPTLYLPVLAWVFVLPLL                               141 - 183
//

Text Mined References (6)

PMID Year Title
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18360792 2009 Cloning and characterization of a human LYPD7, a new member of the Ly-6 superfamily.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.