Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.77
PubTator Score 1.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.072 2.4e-02
chronic rhinosinusitis -1.045 4.7e-03
fibroadenoma 1.200 7.2e-03
group 3 medulloblastoma -1.400 5.3e-03
Hydrolethalus syndrome 2.028 4.5e-02
interstitial cystitis -1.700 1.5e-02
intraductal papillary-mucinous adenoma (... 2.200 2.9e-05
non-small cell lung cancer 1.852 7.3e-14
ovarian cancer 2.200 1.9e-05
pituitary cancer 1.900 1.8e-03
psoriasis -1.200 2.2e-52

Protein-protein Interaction (9)

Gene RIF (2)

AA Sequence

MLYKSSDRPAHKVSMLLLCHALAIAVVQIVIFSESWAFAKNINFYNVRPPLDPTPFPNSFKCFTCENAGD      1 - 70
NYNCNRWAEDKWCPQNTQYCLTVHHFTSHGRSTSITKKCASRSECHFVGCHHSRDSEHTECRSCCEGMIC     71 - 140
NVELPTNHTNAVFAVMHAQRTSGSSAPTLYLPVLAWVFVLPLL                               141 - 183
//

Text Mined References (7)

PMID Year Title