Property Summary

NCBI Gene PubMed Count 5
PubMed Score 17.28
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 6.66183560051258E-45
osteosarcoma 7933 2.28721572790967E-7
group 4 medulloblastoma 1875 2.96284223914602E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.6028878389952E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.84146035565282E-4
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Tracheal stenosis 18 4.477 2.2
Hemiplegia 15 3.487 1.7

Expression

  Differential Expression (5)

Synonym

Accession Q8NHY6 A0JNV6 K7ES88 Q8NHU8 Q9BY30 Q9P2B6 Zfp-28
Symbols mkr5

Gene

PDB

2EM2   2EM3   2EM4   2EMJ   2EMK   2EML   2EN9   2ENH   2EOH   2EP0   2EPX   2EPZ   2YTM  

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG

Gene RIF (2)

PMID Text
19329283 these results suggest that murine and human Zfp28/ZFP28 is correlated with the pathogenesis of melanoma.
12127974 Characterization of ZFP28 and its role in human development

AA Sequence

MRGAASASVREPTPLPGRGAPRTKPRAGRGPTVGTPATLALPARGRPRSRNGLASKGQRGAAPTGPGHRA      1 - 70
LPSRDTALPQERNKKLEAVGTGIEPKAMSQGLVTFGDVAVDFSQEEWEWLNPIQRNLYRKVMLENYRNLA     71 - 140
SLGLCVSKPDVISSLEQGKEPWTVKRKMTRAWCPDLKAVWKIKELPLKKDFCEGKLSQAVITERLTSYNL    141 - 210
EYSLLGEHWDYDALFETQPGLVTIKNLAVDFRQQLHPAQKNFCKNGIWENNSDLGSAGHCVAKPDLVSLL    211 - 280
EQEKEPWMVKRELTGSLFSGQRSVHETQELFPKQDSYAEGVTDRTSNTKLDCSSFRENWDSDYVFGRKLA    281 - 350
VGQETQFRQEPITHNKTLSKERERTYNKSGRWFYLDDSEEKVHNRDSIKNFQKSSVVIKQTGIYAGKKLF    351 - 420
KCNECKKTFTQSSSLTVHQRIHTGEKPYKCNECGKAFSDGSSFARHQRCHTGKKPYECIECGKAFIQNTS    421 - 490
LIRHWRYYHTGEKPFDCIDCGKAFSDHIGLNQHRRIHTGEKPYKCDVCHKSFRYGSSLTVHQRIHTGEKP    491 - 560
YECDVCRKAFSHHASLTQHQRVHSGEKPFKCKECGKAFRQNIHLASHLRIHTGEKPFECAECGKSFSISS    561 - 630
QLATHQRIHTGEKPYECKVCSKAFTQKAHLAQHQKTHTGEKPYECKECGKAFSQTTHLIQHQRVHTGEKP    631 - 700
YKCMECGKAFGDNSSCTQHQRLHTGQRPYECIECGKAFKTKSSLICHRRSHTGEKPYECSVCGKAFSHRQ    701 - 770
SLSVHQRIHSGKKPYECKECRKTFIQIGHLNQHKRVHTGERSYNYKKSRKVFRQTAHLAHHQRIHTGESS    771 - 840
TCPSLPSTSNPVDLFPKFLWNPSSLPSP                                              841 - 868
//

Text Mined References (6)

PMID Year Title
19329283 2009 Zinc finger protein 28 as a novel melanoma-related molecule.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12127974 2002 Identification and characterization of two novel zinc finger genes, ZNF359 and ZFP28, in human development.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.