Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.25
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia -2.000 4.2e-02
Astrocytoma, Pilocytic 1.900 1.9e-06
breast carcinoma -1.100 2.5e-03
gastric cancer 1.200 1.3e-02
hepatocellular carcinoma 1.700 2.4e-05
interstitial cystitis 1.400 3.5e-03
intraductal papillary-mucinous neoplasm ... -2.300 1.1e-02
invasive ductal carcinoma -1.800 1.6e-02
juvenile dermatomyositis 1.868 7.9e-10
lung adenocarcinoma -1.400 5.1e-13
lung carcinoma -2.000 6.3e-15
mucosa-associated lymphoid tissue lympho... 1.065 3.5e-02
non-small cell lung cancer -2.371 3.6e-18
osteosarcoma -2.160 5.2e-03
ovarian cancer -1.500 3.1e-03
pediatric high grade glioma 1.300 5.0e-03
Pneumonia -1.200 3.3e-03
primary Sjogren syndrome 2.600 6.3e-05
tuberculosis and treatment for 6 months -1.100 5.0e-04
ulcerative colitis 1.800 5.6e-04

Gene RIF (2)

AA Sequence

MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDTPGLFDT      1 - 70
KESLDTTCKEISRCIISSCPGPHAIVLVLLLGRYTEEEQKTVALIKAVFGKSAMKHMVILFTRKEELEGQ     71 - 140
SFHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTE    141 - 210
ERLKQREEVLRKIYTDQLNEEIKLVEEDKHKSEEEKEKEIKLLKLKYDEKIKNIREEAERNIFKDVFNRI    211 - 280
WKMLSEIWHRFLSKCKFYSS                                                      281 - 300
//

Text Mined References (8)

PMID Year Title