Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.41
PubTator Score 2.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVTPSDVRTLVNGFAKNPLQARREGLYFKGKD      1 - 70
YRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSICVEATESLGDYLRKKGS                71 - 129
//

Text Mined References (7)

PMID Year Title