Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.41
PubTator Score 2.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)
19419568 Porfilin 4 bound to selected phosphoinositides but not to poly-L-proline, proline-rich proteins, or actin.

AA Sequence

MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVTPSDVRTLVNGFAKNPLQARREGLYFKGKD      1 - 70
YRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSICVEATESLGDYLRKKGS                71 - 129
//

Text Mined References (7)

PMID Year Title
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19419568 2009 Testis-expressed profilins 3 and 4 show distinct functional characteristics and localize in the acroplaxome-manchette complex in spermatids.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15591451 2005 Novel testis-expressed profilin IV associated with acrosome biogenesis and spermatid elongation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.