Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.41
PubTator Score 2.53

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NHR9 Q53TL9
Symbols

Gene

  Ortholog (13)

Gene RIF (2)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)
19419568 Porfilin 4 bound to selected phosphoinositides but not to poly-L-proline, proline-rich proteins, or actin.

AA Sequence

MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVTPSDVRTLVNGFAKNPLQARREGLYFKGKD      1 - 70
YRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSICVEATESLGDYLRKKGS                71 - 129
//

Text Mined References (7)

PMID Year Title
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19419568 2009 Testis-expressed profilins 3 and 4 show distinct functional characteristics and localize in the acroplaxome-manchette complex in spermatids.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15591451 2005 Novel testis-expressed profilin IV associated with acrosome biogenesis and spermatid elongation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.