Property Summary

NCBI Gene PubMed Count 6
PubMed Score 47.43
PubTator Score 12.41

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.200 4.2e-03
gastric carcinoma 1.100 1.1e-02
group 4 medulloblastoma -1.200 1.4e-05
ovarian cancer 1.200 2.3e-05
pituitary cancer -1.100 4.8e-06
posterior fossa group B ependymoma -1.200 1.8e-10

Gene RIF (2)

AA Sequence

MVGQMYCYPGSHLARALTRALALALVLALLVGPFLSGLAGAIPAPGGRWARDGQVPPASRSRSVLLDVSA      1 - 70
GQLLMVDGRHPDAVAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVN     71 - 140
YCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLTLLQLKGLEDSYEGRVSFPAGKFTIK    141 - 210
PLGFLLLQLSGDLEDLELALNKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQ    211 - 280
FREGPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNI    281 - 350
VANRLASDGATWADIFKRFNSGTYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQK    351 - 420
TYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLS    421 - 490
LCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPF    491 - 560
QWSTSPFSGLLHMGQPDLWKFAPVKVSWD                                             561 - 589
//

Text Mined References (11)

PMID Year Title