Property Summary

NCBI Gene PubMed Count 7
PubMed Score 15.04
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
breast carcinoma 1,614
lung carcinoma 2,844

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.100 0.009
lung carcinoma 1.300 0.000

AA Sequence

MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFLYSDGQSETILGGLGLRMGSSDC      1 - 70
RVKIATKANPWIGNSLKPDSVRSQLETSLKRLQCPUVDLFYLHAPDHSAPVEETLRACHQLHQEGKFVEL     71 - 140
GLSNYAAWEVAEICTLCKSNGWILPTVYQGMYSATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYK    141 - 210
YEDKDGKQPVGRFFGTQWAEIYRNHFWKEHHFEGIALVEKALQAAYGASAPSMTSAALRWMYHHSQLQGA    211 - 280
HGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLFAHECPNYFI                       281 - 331
//

Text Mined References (8)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20171287 2010 Voxelwise genome-wide association study (vGWAS).
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12879023 2003 Aflatoxin B1 aldehyde reductase (AFAR) genes cluster at 1p35-1p36.1 in a region frequently altered in human tumour cells.
12604248 2003 The aldo-keto reductase superfamily homepage.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.