Property Summary

NCBI Gene PubMed Count 8
PubMed Score 16.25
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 2.0e-25
breast carcinoma 1638 9.2e-03

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.100 9.2e-03
lung carcinoma 1.300 2.0e-25

AA Sequence

MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFLYSDGQSETILGGLGLRMGSSDC      1 - 70
RVKIATKANPWIGNSLKPDSVRSQLETSLKRLQCPUVDLFYLHAPDHSAPVEETLRACHQLHQEGKFVEL     71 - 140
GLSNYAAWEVAEICTLCKSNGWILPTVYQGMYSATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYK    141 - 210
YEDKDGKQPVGRFFGTQWAEIYRNHFWKEHHFEGIALVEKALQAAYGASAPSMTSAALRWMYHHSQLQGA    211 - 280
HGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLFAHECPNYFI                       281 - 331
//

Text Mined References (9)

PMID Year Title