Property Summary

NCBI Gene PubMed Count 107
Grant Count 111
R01 Count 68
Funding $11,113,961.47
PubMed Score 168.19
PubTator Score 233.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NHL6 A2IXV4 A8MXT0 O75024 O75025 Q8NHJ9 Q8NHK0 LIR-1
Symbols ILT2
LIR1
MIR7
PIRB
CD85J
ILT-2
LIR-1
MIR-7
PIR-B

Gene

PDB

1P7Q   4NO0   1G0X   1UFU   1UGN   1VDG   3D2U   4LL9  

Gene RIF (67)

PMID Text
26739048 Surprisingly, the ability of LIR1(+) natural killer cells to control virus spread differed between human cytomegalovirus strains, and this phenomenon was dependent on amino acid sequences within the viral ligand UL18.
26314621 LIR-1 expression on CD8+ T cells in Rheumatoid Arthritis patients was higher than that in healthy controls.
25855135 One SNP in LILRB1 (5724G>A) influenced the risk of NSCLC. 5724G>A was associated with protection from tumor cell infiltration of regional lymph nodes. Expression in tumor tissue correlated with tumor stage.
25853899 Our findings offer new insights into the immunopathology of rheumatoid arthritis(RA) patients with long-lasting anti-RA-treatment and highlight the importance to also measure the binding capability of sHLA-G to LILRB1
25726929 Patients expressing high levels of CD85j had an impaired ability to lyse triple negative breast cancer cells in the presence of Cetuximab. We also found that CD85j overexpression was associated with HLA-I and soluble HLA-G expression by tumors.
25070049 MiR-7, inhibited indirectly by lincRNA HOTAIR, directly inhibits SETDB1 and reverses the Epithelial-mesenchymal transition of breast cancer stem cells by down regulating the STAT3 pathway
24909369 Increased frequency of ILT2-expressing CD56(dim)CD16(+) NK cells correlates with disease severity of pulmonary tuberculosis.
24550301 To escape antiviral response, antibody-opsonized dengue virus coligates LILRB1 to inhibit FcgammaR signaling for type-I IFN-stimulated gene expression.
24453251 This B cell regulatory mechanism involving ILT2-HLA-G interaction brings important insight to design future B cell-targeted therapies aimed at reducing inappropriate immune reaction in allotransplantation and autoimmune diseases.
24162774 HIV-1 gp120 downregulates the expression of leukocyte immunoglobulin-like receptor, subfamily B, member 1 (LILRB1) in human B cells
More...

AA Sequence

MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWI      1 - 70
TRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGN     71 - 140
VILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSL    141 - 210
PSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQA    211 - 280
NFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQG    281 - 350
WMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVS    351 - 420
GPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVILLLLLLLLLFLILRHRRQGK    421 - 490
HWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKHTQPEDGVEMDTRSPHDEDPQAV    491 - 560
TYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSLTLRREATEPP    561 - 630
PSQEGPSPAVPSIYATLAIH                                                      631 - 650
//

Text Mined References (108)

PMID Year Title
26739048 2016 Leukocyte Immunoglobulin-Like Receptor 1-Expressing Human Natural Killer Cell Subsets Differentially Recognize Isolates of Human Cytomegalovirus through the Viral Major Histocompatibility Complex Class I Homolog UL18.
26314621 2016 Latent Cytomegalovirus Infection in Rheumatoid Arthritis and Increased Frequencies of Cytolytic LIR-1+CD8+ T Cells.
25855135 2015 Genetic polymorphisms and expression of HLA-G and its receptors, KIR2DL4 and LILRB1, in non-small cell lung cancer.
25853899 2015 The paradox of high availability and low recognition of soluble HLA-G by LILRB1 receptor in rheumatoid arthritis patients.
25726929 2015 Overexpression of CD85j in TNBC patients inhibits Cetuximab-mediated NK-cell ADCC but can be restored with CD85j functional blockade.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
25070049 2014 MiR-7, inhibited indirectly by lincRNA HOTAIR, directly inhibits SETDB1 and reverses the EMT of breast cancer stem cells by downregulating the STAT3 pathway.
24909369 2014 Increased frequency of ILT2-expressing CD56(dim)CD16(+) NK cells correlates with disease severity of pulmonary tuberculosis.
24550301 2014 Leukocyte immunoglobulin-like receptor B1 is critical for antibody-dependent dengue.
24453251 2014 Binding of HLA-G to ITIM-bearing Ig-like transcript 2 receptor suppresses B cell responses.
More...