Property Summary

NCBI Gene PubMed Count 116
PubMed Score 181.69
PubTator Score 233.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 2.1e-04
cutaneous lupus erythematosus 2.200 1.8e-03
glioblastoma 1.300 4.1e-04
group 4 medulloblastoma -1.400 1.2e-03
head and neck cancer and chronic obstruc... 1.700 1.6e-03
interstitial cystitis 1.200 7.8e-04
lung carcinoma -1.200 2.8e-16
medulloblastoma, large-cell -1.900 1.6e-05
mucosa-associated lymphoid tissue lympho... 1.421 4.2e-02
non-small cell lung cancer -1.154 6.5e-09
osteosarcoma -1.281 6.3e-03
ovarian cancer 1.400 7.2e-03
primary Sjogren syndrome 2.000 4.6e-04
psoriasis 1.400 1.8e-43
subependymal giant cell astrocytoma 2.897 5.0e-03
ulcerative colitis 3.000 1.2e-06

Gene RIF (75)

AA Sequence

MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWI      1 - 70
TRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGN     71 - 140
VILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSL    141 - 210
PSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQA    211 - 280
NFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQG    281 - 350
WMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVS    351 - 420
GPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVILLLLLLLLLFLILRHRRQGK    421 - 490
HWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKHTQPEDGVEMDTRSPHDEDPQAV    491 - 560
TYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSLTLRREATEPP    561 - 630
PSQEGPSPAVPSIYATLAIH                                                      631 - 650
//

Text Mined References (117)

PMID Year Title