Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (313)

Synonym

Accession Q8NH74 Q6IF59
Symbols OR11-96

Gene

  Ortholog (4)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Platypus OMA Inparanoid

AA Sequence

MERQNQSCVVEFILLGFSNYPELQGQLFVAFLVIYLVTLIGNAIIIVIVSLDQSLHVPMYLFLLNLSVVD      1 - 70
LSFSAVIMPEMLVVLSTEKTTISFGGCFAQMYFILLFGGAECFLLGAMAYDRFAAICHPLNYQMIMNKGV     71 - 140
FMKLIIFSWALGFMLGTVQTSWVSSFPFCGLNEINHISCETPAVLELACADTFLFEIYAFTGTFLIILVP    141 - 210
FLLILLSYIRVLFAILKMPSTTGRQKAFSTCAAHLTSVTLFYGTASMTYLQPKSGYSPETKKVMSLSYSL    211 - 280
LTPLLNLLIYSLRNSEMKRALMKLWRRRVVLHTI                                        281 - 314
//

Text Mined References (3)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
14983052 2004 The human olfactory receptor gene family.