Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.20

Knowledge Summary

Patent (100)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
pancreatic ductal carcinoma 11 4.126 2.1

AA Sequence

MSQVTNTTQEGIYFILTDIPGFEASHIWISIPVCCLYTISIMGNTTILTVIRTEPSVHQRMYLFLSMLAL      1 - 70
TDLGLTLTTLPTVMQLLWFNVRRISSEACFAQFFFLHGFSFMESSVLLAMSVDCYVAICCPLHYASILTN     71 - 140
EVIGRTGLAIICCCVLAVLPSLFLLKRLPFCHSHLLSRSYCLHQDMIRLVCADIRLNSWYGFALALLIII    141 - 210
VDPLLIVISYTLILKNILGTATWAERLRALNNCLSHILAVLVLYIPMVGVSMTHRFAKHASPLVHVIMAN    211 - 280
IYLLAPPVMNPIIYSVKNKQIQWGMLNFLSLKNMHSR                                     281 - 317
//

Text Mined References (4)

PMID Year Title