Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.06

Knowledge Summary

Patent (100)


  Disease Sources (1)

Disease Target Count Z-score Confidence
pancreatic ductal carcinoma 11 4.394 2.2

AA Sequence

IYLLAPPVMNPIIYSVKNKQIQWGMLNFLSLKNMHSR                                     281 - 317

Text Mined References (4)

PMID Year Title
17973576 2007 Genetic elucidation of human hyperosmia to isovaleric acid.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.