Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent (186)

AA Sequence

MSFLNGTSLTPASFILNGIPGLEDVHLWISFPLCTMYSIAITGNFGLMYLIYCDEALHRPMYVFLALLSF      1 - 70
TDVLMCTSTLPNTLFILWFNLKEIDFKACLAQMFFVHTFTGMESGVLMLMALDHCVAICFPLRYATILTN     71 - 140
SVIAKAGFLTFLRGVMLVIPSTFLTKRLPYCKGNVIPHTYCDHMSVAKISCGNVRVNAIYGLIVALLIGG    141 - 210
FDILCITISYTMILQAVVSLSSADARQKAFSTCTAHFCAIVLTYVPAFFTFFTHHFGGHTIPLHIHIIMA    211 - 280
NLYLLMPPTMNPIVYGVKTRQVRESVIRFFLKGKDNSHNF                                  281 - 320
//

Text Mined References (1)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.