Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (104)

Synonym

Accession Q8NH18 Q6IEU5
Symbols OR11-266

Gene

  Ortholog (6)

Species Source
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Dog OMA Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Opossum OMA Inparanoid

AA Sequence

MADDNFTVVTEFILLGLTDHAELKAVLFVVFLVIYAITLLRNLGMILLIQITSKLHTPMYFLLSCLSFVD      1 - 70
ACYSSAIAPKMLVNLLVVKATISFSACMVQHLCFGVFITTEGFLLSVMAYDRYVAIVSPLLYTVAMSDRK     71 - 140
CVELVTGSWIGGIVNTLIHTISLRRLSFCRLNAVSHFFCDIPSLLKLSCSDTSMNELLLLTFSGVIAMAT    141 - 210
FLTVIISYIFIAFASLRIHSASGRQQAFSTCASHLTAVTIFYGTLIFSYIQPSSQYFVEQEKVVSMFYTL    211 - 280
GIPMLNLLIHSLRNKDVKEAVKRAIEMKHFLC                                          281 - 312
//

Text Mined References (2)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.