Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.09

Knowledge Summary

Patent (104)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Skin Diseases 71 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

AA Sequence

MADDNFTVVTEFILLGLTDHAELKAVLFVVFLVIYAITLLRNLGMILLIQITSKLHTPMYFLLSCLSFVD      1 - 70
ACYSSAIAPKMLVNLLVVKATISFSACMVQHLCFGVFITTEGFLLSVMAYDRYVAIVSPLLYTVAMSDRK     71 - 140
CVELVTGSWIGGIVNTLIHTISLRRLSFCRLNAVSHFFCDIPSLLKLSCSDTSMNELLLLTFSGVIAMAT    141 - 210
FLTVIISYIFIAFASLRIHSASGRQQAFSTCASHLTAVTIFYGTLIFSYIQPSSQYFVEQEKVVSMFYTL    211 - 280
GIPMLNLLIHSLRNKDVKEAVKRAIEMKHFLC                                          281 - 312
//

Text Mined References (2)

PMID Year Title