Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 27.33

Knowledge Summary

Patent (141)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

AA Sequence

MGMVRHTNESNLAGFILLGFSDYPQLQKVLFVLILILYLLTILGNTTIILVSRLEPKLHMPMYFFLSHLS      1 - 70
FLYRCFTSSVIPQLLVNLWEPMKTIAYGGCLVHLYNSHALGSTECVLPAVMSCDRYVAVCRPLHYTVLMH     71 - 140
IHLCMALASMAWLSGIATTLVQSTLTLQLPFCGHRQVDHFICEVPVLIKLACVGTTFNEAELFVASILFL    141 - 210
IVPVSFILVSSGYIAHAVLRIKSATRRQKAFGTCFSHLTVVTIFYGTIIFMYLQPAKSRSRDQGKFVSLF    211 - 280
YTVVTRMLNPLIYTLRIKEVKGALKKVLAKALGVNIL                                     281 - 317
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14983052 2004 The human olfactory receptor gene family.