Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 27.33

Knowledge Summary

Patent (141)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

AA Sequence

MGMVRHTNESNLAGFILLGFSDYPQLQKVLFVLILILYLLTILGNTTIILVSRLEPKLHMPMYFFLSHLS      1 - 70
FLYRCFTSSVIPQLLVNLWEPMKTIAYGGCLVHLYNSHALGSTECVLPAVMSCDRYVAVCRPLHYTVLMH     71 - 140
IHLCMALASMAWLSGIATTLVQSTLTLQLPFCGHRQVDHFICEVPVLIKLACVGTTFNEAELFVASILFL    141 - 210
IVPVSFILVSSGYIAHAVLRIKSATRRQKAFGTCFSHLTVVTIFYGTIIFMYLQPAKSRSRDQGKFVSLF    211 - 280
YTVVTRMLNPLIYTLRIKEVKGALKKVLAKALGVNIL                                     281 - 317
//

Text Mined References (2)

PMID Year Title