Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.71
PubTator Score 22.08

Knowledge Summary

Patent (246)

Gene RIF (7)

PMID Text
19709766 Observational study of gene-disease association. (HuGE Navigator)
19166692 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18599554 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
16175505 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNHSVVTEFIILGLTKKPELQGIIFLFFLIVYLVAFLGNMLIIIAKIYNNTLHTPMYVFLLTLAVVDIIC      1 - 70
TTSIIPKMLGTMLTSENTISYAGCMSQLFLFTWSLGAEMVLFTTMAYDRYVAICFPLHYSTIMNHHMCVA     71 - 140
LLSMVMAIAVTNSWVHTALIMRLTFCGPNTIDHFFCEIPPLLALSCSPVRINEVMVYVADITLAIGDFIL    141 - 210
TCISYGFIIVAILRIRTVEGKRKAFSTCSSHLTVVTLYYSPVIYTYIRPASSYTFERDKVVAALYTLVTP    211 - 280
TLNPMVYSFQNREMQAGIRKVFAFLKH                                               281 - 307
//

Text Mined References (11)

PMID Year Title
19709766 2011 Variations of specific non-candidate genes and risk of myocardial infarction: a replication study.
19166692 2009 Usefulness of genetic polymorphisms and conventional risk factors to predict coronary heart disease in patients with familial hypercholesterolemia.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18599554 2008 Replication study of 10 genetic polymorphisms associated with coronary heart disease in a specific high-risk population with familial hypercholesterolemia.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16175505 2005 Identification of four gene variants associated with myocardial infarction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
More...