Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.76
PubTator Score 22.08

Knowledge Summary

Patent (246)

Gene RIF (7)

AA Sequence

MNHSVVTEFIILGLTKKPELQGIIFLFFLIVYLVAFLGNMLIIIAKIYNNTLHTPMYVFLLTLAVVDIIC      1 - 70
TTSIIPKMLGTMLTSENTISYAGCMSQLFLFTWSLGAEMVLFTTMAYDRYVAICFPLHYSTIMNHHMCVA     71 - 140
LLSMVMAIAVTNSWVHTALIMRLTFCGPNTIDHFFCEIPPLLALSCSPVRINEVMVYVADITLAIGDFIL    141 - 210
TCISYGFIIVAILRIRTVEGKRKAFSTCSSHLTVVTLYYSPVIYTYIRPASSYTFERDKVVAALYTLVTP    211 - 280
TLNPMVYSFQNREMQAGIRKVFAFLKH                                               281 - 307
//

Text Mined References (11)

PMID Year Title