Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (95)


  Disease (1)

Disease Target Count P-value
diabetes mellitus 1663 1.6e-03

AA Sequence

IVPFFNPAIYCLRNKEVKEAFRKTVMGRCHYPRDVQD                                     281 - 317

Text Mined References (3)

PMID Year Title
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14983052 2004 The human olfactory receptor gene family.