Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.20

Knowledge Summary

Patent (113)

Synonym

Accession Q8NGW1 Q6IFH3
Symbols OR6B3P
OR6B3Q

Gene

  Ortholog (6)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Dog OMA Inparanoid
Cow OMA Inparanoid

AA Sequence

MSGENVTRVGTFILVGFPTAPGLQYLLFLLFLLTYLFVLVENLAIILTVWSSTSLHRPMYYFLSSMSFLE      1 - 70
IWYVSDITPKMLEGFLLQQKRISFVGCMTQLYFFSSLVCTECVLLASMAYDRYVAICHPLRYHVLVTPGL     71 - 140
CLQLVGFSFVSGFTISMIKVCFISSVTFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFP    141 - 210
LLATMLSYAHITLAVLRIPSATGCWRAFFTCASHLTVVTVFYTALLFMYVRPQAIDSRSSNKLISVLYTV    211 - 280
ITPILNPLIYCLRNKEFKNALKKAFGLTSCAVEGRLSSLLELHLQIHSQPL                       281 - 331
//

Text Mined References (1)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.