Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MLGNYSSATEFFLLGFPGSQEVCRILFATFFLLYAVTVMGNVVIIITVCVDKCLQSPIYFFLGHLCVLEI      1 - 70
LITSTAVPFMLWGLLLPSTQIMSLTACAAQLYLYLSLGTLELALMGVMAVDRYVAVCNPLRYNIIMNSST     71 - 140
FIWVIIVSWVLGFLSEIWPVYATFQLTFCKSSVLDHFYCDRGQLLKVSCEDTLFREFILFLMAVFIIIGS    141 - 210
LIPTIVSYTYIISTNLKIPSASGWRKSFSTCASHFTYVVIGYGSCLFLYVKPK                     211 - 263
//

Text Mined References (1)

PMID Year Title
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.