Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent (103)

AA Sequence

MESNQTWITEVILLGFQVDPALELFLFGFFLLFYSLTLMGNGIILGLIYLDSRLHTPMYVFLSHLAIVDM      1 - 70
SYASSTVPKMLANLVMHKKVISFAPCILQTFLYLAFAITECLILVMMCYDRYVAICHPLQYTLIMNWRVC     71 - 140
TVLASTCWIFSFLLALVHITLILRLPFCGPQKINHFFCQIMSVFKLACADTRLNQVVLFAGSAFILVGPL    141 - 210
CLVLVSYLHILVAILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSSHSQERRKILSLFYSLF    211 - 280
NPILNPLIYSLRNAEVKGALKRVLWKQRSM                                            281 - 310
//

Text Mined References (5)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12644552 2003 Population differences in the human functional olfactory repertoire.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.