Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 11.42

Knowledge Summary

Patent (201)

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.3e-03

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 1.3e-03

AA Sequence

MEPLNRTEVSEFFLKGFSGYPALEHLLFPLCSAMYLVTLLGNTAIMAVSVLDIHLHTPVYFFLGNLSTLD      1 - 70
ICYTPTFVPLMLVHLLSSRKTISFAVCAIQMCLSLSTGSTECLLLAITAYDRYLAICQPLRYHVLMSHRL     71 - 140
CVLLMGAAWVLCLLKSVTEMVISMRLPFCGHHVVSHFTCKILAVLKLACGNTSVSEDFLLAGSILLLPVP    141 - 210
LAFICLSYLLILATILRVPSAARCCKAFSTCLAHLAVVLLFYGTIIFMYLKPKSKEAHISDEVFTVLYAM    211 - 280
VTTMLNPTIYSLRNKEVKEAARKVWGRSRASR                                          281 - 312
//

Text Mined References (5)

PMID Year Title