Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.42
PubTator Score 0.42

Knowledge Summary

Patent (111)


  Disease Sources (1)

Disease Target Count Z-score Confidence
Gout 93 0.0 1.0

AA Sequence

SLFYGVMTPMLNPLIYSLRNKDVKAAVKNILCRKNFSDGK                                  281 - 320

Text Mined References (4)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.
14983052 2004 The human olfactory receptor gene family.
12906860 2003 Organization and evolutionary relatedness of OR37 olfactory receptor genes in mouse and human.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.