Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.42
PubTator Score 0.42

Knowledge Summary

Patent (111)


  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Melanoma 711 0.0 0.5
Disease Target Count Z-score Confidence
Gout 106 0.0 1.7

AA Sequence

SLFYGVMTPMLNPLIYSLRNKDVKAAVKNILCRKNFSDGK                                  281 - 320

Text Mined References (4)

PMID Year Title