Property Summary

NCBI Gene PubMed Count 6
Grant Count 4
R01 Count 4
Funding $402,767
PubMed Score 14.41
PubTator Score 14.73

Knowledge Summary

Patent (6,283)

AA Sequence

MSPENQSSVSEFLLLGLPIRPEQQAVFFTLFLGMYLTTVLGNLLIMLLIQLDSHLHTPMYFFLSHLALTD      1 - 70
ISFSSVTVPKMLMDMRTKYKSILYEECISQMYFFIFFTDLDSFLITSMAYDRYVAICHPLHYTVIMREEL     71 - 140
CVFLVAVSWILSCASSLSHTLLLTRLSFCAANTIPHVFCDLAALLKLSCSDIFLNELVMFTVGVVVITLP    141 - 210
FMCILVSYGYIGATILRVPSTKGIHKALSTCGSHLSVVSLYYGSIFGQYLFPTVSSSIDKDVIVALMYTV    211 - 280
VTPMLNPFIYSLRNRDMKEALGKLFSRATFFSW                                         281 - 313
//

Text Mined References (7)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.
14983052 2004 The human olfactory receptor gene family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12908129 2003 Natural selection on the olfactory receptor gene family in humans and chimpanzees.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10706615 2000 The olfactory receptor gene repertoire in primates and mouse: evidence for reduction of the functional fraction in primates.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.