Property Summary

NCBI Gene PubMed Count 6
PubMed Score 14.47
PubTator Score 14.73

Knowledge Summary

Patent (6,283)

AA Sequence

MSPENQSSVSEFLLLGLPIRPEQQAVFFTLFLGMYLTTVLGNLLIMLLIQLDSHLHTPMYFFLSHLALTD      1 - 70
ISFSSVTVPKMLMDMRTKYKSILYEECISQMYFFIFFTDLDSFLITSMAYDRYVAICHPLHYTVIMREEL     71 - 140
CVFLVAVSWILSCASSLSHTLLLTRLSFCAANTIPHVFCDLAALLKLSCSDIFLNELVMFTVGVVVITLP    141 - 210
FMCILVSYGYIGATILRVPSTKGIHKALSTCGSHLSVVSLYYGSIFGQYLFPTVSSSIDKDVIVALMYTV    211 - 280
VTPMLNPFIYSLRNRDMKEALGKLFSRATFFSW                                         281 - 313
//

Text Mined References (7)

PMID Year Title