Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 12.50

Knowledge Summary

Patent (242)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

AA Sequence

MENQSSISEFFLRGISAPPEQQQSLFGIFLCMYLVTLTGNLLIILAIGSDLHLHTPMYFFLANLSFVDMG      1 - 70
LTSSTVTKMLVNIQTRHHTISYTGCLTQMYFFLMFGDLDSFFLAAMAYDRYVAICHPLCYSTVMRPQVCA     71 - 140
LMLALCWVLTNIVALTHTFLMARLSFCVTGEIAHFFCDITPVLKLSCSDTHINEMMVFVLGGTVLIVPFL    141 - 210
CIVTSYIHIVPAILRVRTRGGVGKAFSTCSSHLCVVCVFYGTLFSAYLCPPSIASEEKDIAAAAMYTIVT    211 - 280
PMLNPFIYSLRNKDMKGALKRLFSHRSIVSS                                           281 - 311
//

Text Mined References (5)

PMID Year Title
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9500546 1998 Distribution of olfactory receptor genes in the human genome.