Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 12.50

Knowledge Summary

Patent (242)

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 2.1e-03

AA Sequence

MENQSSISEFFLRGISAPPEQQQSLFGIFLCMYLVTLTGNLLIILAIGSDLHLHTPMYFFLANLSFVDMG      1 - 70
LTSSTVTKMLVNIQTRHHTISYTGCLTQMYFFLMFGDLDSFFLAAMAYDRYVAICHPLCYSTVMRPQVCA     71 - 140
LMLALCWVLTNIVALTHTFLMARLSFCVTGEIAHFFCDITPVLKLSCSDTHINEMMVFVLGGTVLIVPFL    141 - 210
CIVTSYIHIVPAILRVRTRGGVGKAFSTCSSHLCVVCVFYGTLFSAYLCPPSIASEEKDIAAAAMYTIVT    211 - 280
PMLNPFIYSLRNKDMKGALKRLFSHRSIVSS                                           281 - 311
//

Text Mined References (5)

PMID Year Title