Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.05
PubTator Score 0.07

Knowledge Summary

Patent (79)

AA Sequence

MSKTSLVTAFILTGLPHAPGLDAPLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYFLTNLSFIDMW      1 - 70
FSTVTVPKMLMTLVSPSGRAISFHSCVAQLYFFHFLGSTECFLYTVMSYDRYLAISYPLRYTSMMSGSRC     71 - 140
ALLATSTWLSGSLHSAVQTILTFHLPYCGPNQIQHYLCDAPPILKLACADTSANEMVIFVDIGLVASGCF    141 - 210
LLIVLSYVSIVCSILRIHTSEGRHRAFQTCASHCIVVLCFFVPCVFIYLRPGSRDVVDGVVAIFYTVLTP    211 - 280
LLNPVVYTLRNKEVKKAVLKLRDKVAHSQGE                                           281 - 311
//

Text Mined References (1)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.